Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Genetic Insert: non-specific hairpin
Vector Backbone Description: Backbone Marker:Open Biosystems; Backbone Size:11315; Vector Backbone:pLemiR; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21753754
Proper citation: RRID:Addgene_32809 Copy
Species: Homo sapiens
Genetic Insert: RIAM
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5200; Vector Backbone:pcDNA4/HisMAX; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_32803 Copy
Species: Homo sapiens
Genetic Insert: PANK1
Vector Backbone Description: Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26094); Vector Backbone:pET28a-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: PDB: 3SMP. http://www.thesgc.org/structures/3SMP/
Proper citation: RRID:Addgene_32871 Copy
Species: Rattus norvegicus
Genetic Insert: μ2 subunit of clathrin adaptor complex AP-2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:10228163
Comments: NB: The HA tag (YPYDVPDYALE) was inserted within the protein, between residues 236 and 237.
Proper citation: RRID:Addgene_32752 Copy
Species: Toxoplasma gondii
Genetic Insert: MAPK2
Vector Backbone Description: Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096; Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: PDB: 3RP9. http://www.thesgc.org/structures/3RP9/
Proper citation: RRID:Addgene_32862 Copy
Species: Homo sapiens
Genetic Insert: SETD1A
Vector Backbone Description: Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: PDB: 3S8S. http://www.thesgc.org/structures/3S8S/
Proper citation: RRID:Addgene_32868 Copy
Genetic Insert: GFP
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3970; Vector Backbone:pmKate2-C; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:21558267
Comments: The gene for dark GFP (S65T) (referred to as GFP from this point forward) was created by PCR amplifying the GFP gene using a reverse primer that also encoded the 27 amino acid quenching peptide derived from the transmembrane region of influenza M2. A sequence encoding the linker (LEVLFQGP) was then inserted between the EGFP and M2 genes using the QuikChange mutagenesis (Stratagene) approach. The newly inserted linker sequence was then mutated to encode the caspase-7 cleavage recognition site (DEVDFQGP). The final sequence of CA-GFP protein is GFP with the fusion of DEVDFQGPCNDSSDPLVVAASIIGILHLILWILDRL at the C terminus. This construct was used for expression and purification of CA-GFP.
Proper citation: RRID:Addgene_32748 Copy
Vector Backbone Description: Backbone Size:16482; Vector Backbone:pEMS1307; Vector Types:Pleiades Promoter Project [sic, Pleaides Plieades]; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20807748
Proper citation: RRID:Addgene_29149 Copy
Species: E. coli
Genetic Insert: DHFR(DD)-YFP
Vector Backbone Description: Backbone Marker:Garry Nolan; Backbone Size:6943; Vector Backbone:pBMN; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20851347
Proper citation: RRID:Addgene_29325 Copy
Species: Homo sapiens
Genetic Insert: Ple15
Vector Backbone Description: Backbone Size:18843; Vector Backbone:pEMS1313; Vector Types:Pleiades Promoter Project [sic, Pleaides Plieades]; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24761428
Proper citation: RRID:Addgene_29236 Copy
Species: Homo sapiens
Genetic Insert: DJ1
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:4000; Vector Backbone:pcDNA3.1/GS; Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:12851414
Proper citation: RRID:Addgene_29340 Copy
Species: Gallus gallus
Genetic Insert: AP-SEMA3A (chick)
Vector Backbone Description: Backbone Size:6000; Vector Backbone:pAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9331347
Proper citation: RRID:Addgene_29448 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SUP45 gene encoding translation release factor 1 from S. cerevisiae
Vector Backbone Description: Backbone Size:5976; Vector Backbone:pRS315; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20444877
Proper citation: RRID:Addgene_29383 Copy
Species: Homo sapiens
Genetic Insert: DJ1
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:9000; Vector Backbone:pLenti6/V5-DEST; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_29419 Copy
Species: Mus musculus
Genetic Insert: Venus CAM KII Alpha
Vector Backbone Description: Backbone Size:3984; Vector Backbone:pEGFP C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:19339497
Proper citation: RRID:Addgene_29429 Copy
Species: Mus musculus
Genetic Insert: Venus CamKII alpha
Vector Backbone Description: Backbone Size:3984; Vector Backbone:pEGFP N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:19339497
Proper citation: RRID:Addgene_29427 Copy
Genetic Insert: Venus-17-Venus
Vector Backbone Description: Backbone Size:3984; Vector Backbone:pEGFP C1; Vector Types:Mammalian Expression, Anisotropy and brightness standard; Bacterial Resistance:Kanamycin
Defining Citation: PMID:19339497
Comments: Anisotropy standard and brightness standard
Linker sequence: TCCGGACTCAGATCTCGAGCTCAAGCTTCGAATTCTGCAGTCGACGGTACCAGCAAGG
Proper citation: RRID:Addgene_29424 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SUP45 gene encoding translation release factor 1 from S. cerevisiae
Vector Backbone Description: Backbone Size:5976; Vector Backbone:pRS315; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20444877
Proper citation: RRID:Addgene_29388 Copy
Species: Homo sapiens
Genetic Insert: DJ1
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:4000; Vector Backbone:pcDNA3.1/GS; Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:12851414
Proper citation: RRID:Addgene_29345 Copy
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:7142; Vector Backbone:pcDNA3.2/V5-DEST; Vector Types:Mammalian Expression; Bacterial Resistance:Chloramphenicol and Kanamycin
Defining Citation: PMID:21375737
Comments: Generic promoter-less destination vector
Proper citation: RRID:Addgene_29496 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
