Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pLemiR-NS Resource Report Resource Website 1+ mentions |
RRID:Addgene_32809 | non-specific hairpin | Ampicillin | PMID:21753754 | Backbone Marker:Open Biosystems; Backbone Size:11315; Vector Backbone:pLemiR; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:44 | 3 | |||
|
His-RIAM Resource Report Resource Website 1+ mentions |
RRID:Addgene_32803 | RIAM | Homo sapiens | Ampicillin | Backbone Marker:Invitrogen; Backbone Size:5200; Vector Backbone:pcDNA4/HisMAX; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:49 | 2 | |||
|
PANK1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_32871 | PANK1 | Homo sapiens | Kanamycin | PDB: 3SMP. http://www.thesgc.org/structures/3SMP/ | Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26094); Vector Backbone:pET28a-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | amino acids 231-597 only | 2026-08-15 01:13:44 | 1 | |
|
μ2-HA-WT Resource Report Resource Website 1+ mentions |
RRID:Addgene_32752 | μ2 subunit of clathrin adaptor complex AP-2 | Rattus norvegicus | Ampicillin | PMID:10228163 | NB: The HA tag (YPYDVPDYALE) was inserted within the protein, between residues 236 and 237. | Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:49 | 6 | |
|
PP-MAPK2 (3RP9) Resource Report Resource Website 1+ mentions |
RRID:Addgene_32862 | MAPK2 | Toxoplasma gondii | Kanamycin | PDB: 3RP9. http://www.thesgc.org/structures/3RP9/ | Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096; Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | amino acids 123-548 only, P421L | 2026-08-15 01:13:44 | 1 | |
|
SETD1A Resource Report Resource Website 1+ mentions |
RRID:Addgene_32868 | SETD1A | Homo sapiens | Kanamycin | PDB: 3S8S. http://www.thesgc.org/structures/3S8S/ | Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:44 | 1 | ||
|
pCAGFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_32748 | GFP | Kanamycin | PMID:21558267 | The gene for dark GFP (S65T) (referred to as GFP from this point forward) was created by PCR amplifying the GFP gene using a reverse primer that also encoded the 27 amino acid quenching peptide derived from the transmembrane region of influenza M2. A sequence encoding the linker (LEVLFQGP) was then inserted between the EGFP and M2 genes using the QuikChange mutagenesis (Stratagene) approach. The newly inserted linker sequence was then mutated to encode the caspase-7 cleavage recognition site (DEVDFQGP). The final sequence of CA-GFP protein is GFP with the fusion of DEVDFQGPCNDSSDPLVVAASIIGILHLILWILDRL at the C terminus. This construct was used for expression and purification of CA-GFP. | Backbone Marker:Clontech; Backbone Size:3970; Vector Backbone:pmKate2-C; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | S65T | 2026-08-15 01:13:49 | 3 | |
|
pEMS1307 Resource Report Resource Website 1+ mentions |
RRID:Addgene_29149 | Ampicillin | PMID:20807748 | Backbone Size:16482; Vector Backbone:pEMS1307; Vector Types:Pleiades Promoter Project [sic, Pleaides Plieades]; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:15 | 1 | ||||
|
pBMN DHFR(DD)-YFP Resource Report Resource Website 10+ mentions |
RRID:Addgene_29325 | DHFR(DD)-YFP | E. coli | Ampicillin | PMID:20851347 | Backbone Marker:Garry Nolan; Backbone Size:6943; Vector Backbone:pBMN; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | Change Arg 12 to Tyr (R12Y),Gly 67 to Ser (G67S) and Tyr 100 to Ile (Y100I)--destabilizing domain | 2026-08-15 01:13:18 | 12 | |
|
pEMS1485 Resource Report Resource Website 1+ mentions |
RRID:Addgene_29236 | Ple15 | Homo sapiens | Ampicillin | PMID:24761428 | Backbone Size:18843; Vector Backbone:pEMS1313; Vector Types:Pleiades Promoter Project [sic, Pleaides Plieades]; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:17 | 1 | ||
|
pcDNA3.1/GS-DJ1-R98Q-V5 Resource Report Resource Website 1+ mentions |
RRID:Addgene_29340 | DJ1 | Homo sapiens | Bleocin (Zeocin) | PMID:12851414 | Backbone Marker:Invitrogen; Backbone Size:4000; Vector Backbone:pcDNA3.1/GS; Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin) | Arg98Gln | 2026-08-15 01:13:18 | 1 | |
|
AP-SEMA3A (chick) Resource Report Resource Website 1+ mentions |
RRID:Addgene_29448 | AP-SEMA3A (chick) | Gallus gallus | Ampicillin | PMID:9331347 | Backbone Size:6000; Vector Backbone:pAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:13:19 | 3 | ||
|
pTH375-SUP45-P174Q Resource Report Resource Website 1+ mentions |
RRID:Addgene_29383 | SUP45 gene encoding translation release factor 1 from S. cerevisiae | Saccharomyces cerevisiae | Ampicillin | PMID:20444877 | Backbone Size:5976; Vector Backbone:pRS315; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin | P174Q mutant gene including genomic sequence 1432 bp upstream of AUG and 241 bp downstream of stop codon. | 2026-08-15 01:13:18 | 1 | |
|
pLenti6-DJ1-V5-C53A Resource Report Resource Website 1+ mentions |
RRID:Addgene_29419 | DJ1 | Homo sapiens | Ampicillin | Backbone Marker:Invitrogen; Backbone Size:9000; Vector Backbone:pLenti6/V5-DEST; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | Cys53Ala | 2026-08-15 01:13:19 | 1 | ||
|
Venus Cam KII alpha mutant T286D Resource Report Resource Website 1+ mentions |
RRID:Addgene_29429 | Venus CAM KII Alpha | Mus musculus | Kanamycin | PMID:19339497 | Backbone Size:3984; Vector Backbone:pEGFP C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | T286D mutation in CamKIIa sequence | 2026-08-15 01:13:17 | 1 | |
|
CamKII alpha Venus Resource Report Resource Website 1+ mentions |
RRID:Addgene_29427 | Venus CamKII alpha | Mus musculus | Kanamycin | PMID:19339497 | Backbone Size:3984; Vector Backbone:pEGFP N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:19 | 5 | ||
|
V17V Resource Report Resource Website 1+ mentions |
RRID:Addgene_29424 | Venus-17-Venus | Kanamycin | PMID:19339497 | Anisotropy standard and brightness standard Linker sequence: TCCGGACTCAGATCTCGAGCTCAAGCTTCGAATTCTGCAGTCGACGGTACCAGCAAGG | Backbone Size:3984; Vector Backbone:pEGFP C1; Vector Types:Mammalian Expression, Anisotropy and brightness standard; Bacterial Resistance:Kanamycin | 2026-08-15 01:13:19 | 3 | ||
|
pTH397-SUP45-I222S Resource Report Resource Website 1+ mentions |
RRID:Addgene_29388 | SUP45 gene encoding translation release factor 1 from S. cerevisiae | Saccharomyces cerevisiae | Ampicillin | PMID:20444877 | Backbone Size:5976; Vector Backbone:pRS315; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin | I222S mutant gene (corresponding to the sup45-2 allele) including genomic sequence 1432 bp upstream of AUG and 241 bp downstream of stop codon. | 2026-08-15 01:13:17 | 1 | |
|
pcDNA3.1/GS-DJ1-D149A-V5 Resource Report Resource Website 1+ mentions |
RRID:Addgene_29345 | DJ1 | Homo sapiens | Bleocin (Zeocin) | PMID:12851414 | Backbone Marker:Invitrogen; Backbone Size:4000; Vector Backbone:pcDNA3.1/GS; Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin) | Asp149Ala | 2026-08-15 01:13:18 | 1 | |
|
pcDNA3.2 GW delCMV Resource Report Resource Website 1+ mentions |
RRID:Addgene_29496 | Chloramphenicol and Kanamycin | PMID:21375737 | Generic promoter-less destination vector | Backbone Marker:Invitrogen; Backbone Size:7142; Vector Backbone:pcDNA3.2/V5-DEST; Vector Types:Mammalian Expression; Bacterial Resistance:Chloramphenicol and Kanamycin | 2026-08-15 01:13:20 | 1 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
