Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: eIF3b-knockin-homology arm-mAID-mClover-NeoR
Vector Backbone Description: Backbone Marker:Thermo fisher; Vector Backbone:pCR-Blunt II-TOPO vector(Cat#450245); Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37155573
Comments: Please visit https://www.biorxiv.org/content/10.1101/2022.08.28.505560v2 for bioRxiv preprint.
Proper citation: RRID:Addgene_192237 Copy
Species: Pseudomonas aeruginosa
Genetic Insert: Tse5
Vector Backbone Description: Backbone Marker:Novagen; Vector Backbone:pET29a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:36335275
Comments: Please visit https://doi.org/10.21203/rs.3.rs-967174/v1 for preprint.
Proper citation: RRID:Addgene_192962 Copy
Species: Rattus norvegicus
Genetic Insert: Cb5 tail anchor
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: Transfection of this plasmid will express mCherry-fused to the N-terminus of Cb5 tail anchor sequence" "ITTVESNSSWWTNWVIPAISALVVALMYRLYMAED", which targets the cytoplasmic face of endoplasmic reticulum. There is a flexible, 7 aa linker "SGLRSGK", between mCherry and Cb5.
Proper citation: RRID:Addgene_177407 Copy
Vector Backbone Description: Backbone Size:5458; Vector Backbone:n/a; Vector Types:Plant Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:36995631
Proper citation: RRID:Addgene_191786 Copy
Species: Synthetic
Genetic Insert: THP4.1
Vector Backbone Description: Vector Backbone:p15A; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35799063
Proper citation: RRID:Addgene_190613 Copy
Species: Arabidopsis thaliana
Genetic Insert: [35S-P19][35S-CTPSSU-mHSP21-3XFLAGnYFP][35S-CTPSSU-deltamPTAC5-cYFPX3HA][35S-SP_SV40-CFP]
Vector Backbone Description: Backbone Marker:Engler et al. 2014; Vector Backbone:pAGM4673; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35619173
Comments: Please visit https://www.biorxiv.org/content/10.1101/2021.03.01.433373v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_172819 Copy
Species: Homo sapiens
Genetic Insert: NPM1
Vector Backbone Description: Vector Backbone:pHcRed-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:31831844
Comments: Please note: Plasmid contains an E2K mutation in NPM1 of the NPM1c-C1 insert. This mutation is not known to affect plasmid function.
Proper citation: RRID:Addgene_131821 Copy
Vector Backbone Description: Vector Backbone:p15A; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:18055596
Proper citation: RRID:Addgene_64857 Copy
Species: Homo sapiens
Genetic Insert: NPM1
Vector Backbone Description: Vector Backbone:pHcRed-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:31831844
Proper citation: RRID:Addgene_131818 Copy
Species: Drosophila melanogaster
Genetic Insert: DmGe1_1220-1354
Vector Backbone Description: Vector Backbone:Unknown; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:18755833
Comments: ORF extracted from NCBI: NM_135642.2. Plasmids from this collection were made available to the research community and donated after the lab closed. Please note that the sequence provided by the depositing laboratory may be theoretical/predicted or based on Sanger sequencing results. There may be discrepancies between sequencing results obtained by Addgene and the depositor sequence. If an Addgene verified sequence is not available, please contact [email protected] before placing your order to request that our lab fully sequence the plasmid.
Proper citation: RRID:Addgene_146420 Copy
Species: Arabidopsis thaliana
Genetic Insert: [35S-P19][35S-CTPSSU-mCHERRY-3XFLAGnYFP][35S-CTPSSU-mHSP21-cYFPX3HA][35S-SP_SV40-CFP]
Vector Backbone Description: Backbone Marker:Engler et al. 2014; Vector Backbone:pAGM4673; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35619173
Comments: Please visit https://www.biorxiv.org/content/10.1101/2021.03.01.433373v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_172820 Copy
Species: Homo sapiens
Genetic Insert: NPM1
Vector Backbone Description: Vector Backbone:pHcRed-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:31831844
Proper citation: RRID:Addgene_131838 Copy
Genetic Insert: RBCS1a(1–79)
Vector Backbone Description: Vector Backbone:pGWT35S; Vector Types:Plant Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28894649
Proper citation: RRID:Addgene_182586 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: sopB
Vector Backbone Description: Backbone Marker:Novagen; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35484249
Proper citation: RRID:Addgene_183676 Copy
Species: Salmonella enterica serovar Typhimurium
Genetic Insert: sopB
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35484249
Proper citation: RRID:Addgene_183658 Copy
Species: Synthetic
Genetic Insert: KON168
Vector Backbone Description: Vector Backbone:pGWT35S; Vector Types:Plant Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29661017
Proper citation: RRID:Addgene_182727 Copy
Species: Salmonella enterica serovar Typhimurium
Genetic Insert: sopB
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35484249
Proper citation: RRID:Addgene_183662 Copy
Species: Salmonella enterica serovar Typhimurium
Genetic Insert: sopB
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35484249
Proper citation: RRID:Addgene_183663 Copy
Species: Salmonella enterica serovar Typhimurium
Genetic Insert: sopB
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35484249
Proper citation: RRID:Addgene_183661 Copy
Species: Salmonella enterica serovar Typhimurium
Genetic Insert: sopB
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35484249
Proper citation: RRID:Addgene_183665 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
