Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Genetic Insert: tdTomato
Vector Backbone Description: Backbone Marker:Rachael Neve; Vector Backbone:Derived from AAV V032; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27661450
Comments: Please note that mutation T230I in TdTomato was found during Addgene's quality control. The depositor noted that this mutation does NOT affect plasmid function.
For more info regarding the plasmid, see RAM manuscript on eLife's homepage: http://dx.doi.org/10.7554/eLife.13918
Proper citation: RRID:Addgene_84468 Copy
Species: Synthetic
Genetic Insert: FLIP - Puro
Vector Backbone Description: Backbone Marker:TAKARA; Vector Backbone:pUC118; Vector Types:Mouse Targeting, Cre/Lox; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28135257
Proper citation: RRID:Addgene_84538 Copy
Vector Backbone Description: Backbone Size:0; Vector Backbone:pUMVC; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Kanamycin
Defining Citation: PMID:12649500
Comments: Packaging plasmid for MuLV constructs, MuLV gag and pol (no envelope). The 293T cell line can be obtained from the Weinberg lab or GenHunter http://genhunter.com/products/aptag-3/index.html
See pUMVC3-gag-pol for a map/sequence.
Proper citation: RRID:Addgene_8449 Copy
Species: Mus musculus
Genetic Insert: Mouse c-myc (exons II and III)
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:3000; Vector Backbone:pSP64; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:8455630
Proper citation: RRID:Addgene_8448 Copy
Species: Homo sapiens
Genetic Insert: CASTOR1
Vector Backbone Description: Vector Backbone:pRK5; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26972053
Proper citation: RRID:Addgene_84488 Copy
Species: Stigeoclonium helveticum
Genetic Insert: Chronos-tdTomato
Vector Backbone Description: Backbone Marker:original from Stratagene; Backbone Size:4684; Vector Backbone:AAV-Syn-FLEX; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24509633
Comments: The plasmid is fully sequenced in the coding sequence regions (opsin-fluorophore and important flanking regions). Multiple digestions were done to verify the vector structure. The construct and the virus were both tested in vitro.
Proper citation: RRID:Addgene_84481 Copy
Species: Chlamydomonas noctigama
Genetic Insert: ChrimsonR-GFP
Vector Backbone Description: Backbone Marker:original from Stratagene; Backbone Size:4684; Vector Backbone:AAV-Syn-FLEX; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24509633
Comments: The plasmid is fully sequenced in the coding sequence regions (opsin-fluorophore and important flanking regions). Multiple digestions were done to verify the vector structure. The construct and the virus were both tested in vitro.
Proper citation: RRID:Addgene_84480 Copy
Species: Stigeoclonium helveticum
Genetic Insert: Chronos-GFP
Vector Backbone Description: Backbone Marker:original from Stratagene; Backbone Size:4670; Vector Backbone:AAV-Syn-FLEX; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24509633
Comments: The plasmid is fully sequenced in the coding sequence regions (opsin-fluorophore and important flanking regions). Multiple digestions were done to verify the vector structure. The construct and the virus were both tested in vitro.
Proper citation: RRID:Addgene_84482 Copy
Vector Backbone Description: Backbone Size:7032; Vector Backbone:pLKO.1; Vector Types:Mammalian Expression, Lentiviral, RNAi; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12649500
Comments: Empty lentiviral vector for siRNA expression; replaces Lentihair; see author's map. The 293T cell line can be obtained from the Weinberg lab or GenHunter http://genhunter.com/products/aptag-3/index.html
Note that Addgene's quality control sequence shows that there are about 25 nucleotides between the AgeI and EcoRI sites (the depositor sequences is not as accurate in this region).
For packaging, please use pCMV-dR8.2 dvpr (Addgene plasmid #8455) and pCMV-VSVG (Addgene plasmid #8454). For the official vector of The RNAi Consortium and a plasmid map, please see plasmid #10878.
Proper citation: RRID:Addgene_8453 Copy
Genetic Insert: Cas9
Vector Backbone Description: Backbone Size:2623; Vector Backbone:pUC19; Vector Types:Yeast Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27989123
Proper citation: RRID:Addgene_84610 Copy
Vector Backbone Description: Vector Backbone:pUS116; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: pUS116 is an E.coli/Mycobacterium shuttle vector, with high copy number in E.coli and low copy number in Mycobacterium. The plasmid has unique NdeI, BamHI, PvuII, EcoRI, NheI sites for cloning, and genes cloned at this MCS can be expressed via acetamide induction in Mycobacterium, but this system doesnt work in E.coli. This plasmid was made by deletion of the recombineering genes from pJV53 (see van Kessel and Hatfull, 2007), to re-forma basic shuttle/expression vector. pUS116 is equivalent to vector pLAM12.
Proper citation: RRID:Addgene_84578 Copy
Genetic Insert: hrGFP
Vector Backbone Description: Backbone Size:2623; Vector Backbone:pUC19; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27989123
Proper citation: RRID:Addgene_84616 Copy
Genetic Insert: hrGFP
Vector Backbone Description: Backbone Size:2623; Vector Backbone:pUC19; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27989123
Proper citation: RRID:Addgene_84617 Copy
Species: Rattus norvegicus
Genetic Insert: microtubule-associated protein 1 light chain 3 beta
Vector Backbone Description: Backbone Marker:Dr.Shoji Yamaoka of Tokyo Medical and Dental University; Backbone Size:6100; Vector Backbone:pMRX-IP; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27818143
Proper citation: RRID:Addgene_84572 Copy
Vector Backbone Description: Backbone Size:7547; Vector Backbone:pMuLE Lenti Dest Neo; Vector Types:Mammalian Expression, Lentiviral, Gateway Cloning; Bacterial Resistance:Chloramphenicol and Ampicillin
Defining Citation: PMID:30061623
Proper citation: RRID:Addgene_84574 Copy
Species: Synthetic
Genetic Insert: mCherry
Vector Backbone Description: Backbone Marker:K. Kawakami lab; Vector Backbone:pT2KXIG; Vector Types:Zebrafish transgenesis; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25068273
Comments: The amino acid sequence of the Odc1-derived destabilizing element is: SHGFPPAVAAQDDGTLPMSCAQESGMDRHPAACASARINV.
Proper citation: RRID:Addgene_84603 Copy
Species: Homo sapiens
Genetic Insert: Rac1
Vector Backbone Description: Backbone Marker:Iain Fraser (Addgene plasmid # 25734); Vector Backbone:pSLIK; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25044255
Proper citation: RRID:Addgene_84605 Copy
Genetic Insert: Cas9
Vector Backbone Description: Backbone Size:2623; Vector Backbone:pUC19; Vector Types:Yeast Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27989123
Proper citation: RRID:Addgene_84608 Copy
Species: Mus musculus
Genetic Insert: FLAG tag, Suntag, oxBFP, Auxin-inducible degron, beta-actin 3'UTR, MS2V5 stem-loops
Vector Backbone Description: Backbone Size:6255; Vector Backbone:pUbC lentivirus expression vector (2nd generation); Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27313041
Proper citation: RRID:Addgene_84561 Copy
Species: Synthetic
Genetic Insert: Transport inhibitor response 1 (E3 ligase domain), IRES, single chain variable fragment-superfolder GFP
Vector Backbone Description: Vector Backbone:pUbC lentivirus expression vector (2nd generation); Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27313041
Proper citation: RRID:Addgene_84563 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
