Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
On page 351 showing 7001 ~ 7020 out of 12,972 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

    • RRID:Addgene_111271

    This resource has 1+ mentions.

http://www.addgene.org/111271

Species: Mus musculus
Genetic Insert: murine Syk tandem SH2 domains (Ser 8 to Gln 264), with Y130E mutation to mimic phosphorylation
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREEVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ

Proper citation: RRID:Addgene_111271 Copy   

    • RRID:Addgene_111273

http://www.addgene.org/111273

Species: Mus musculus
Genetic Insert: murine Syk (N)SH2 domain plus interdomain A (Ser 8 to His 162), with an N-terminal (His)6 tag and TEV cleavage site
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MHHHHHHENLYFQGSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAH

Proper citation: RRID:Addgene_111273 Copy   

    • RRID:Addgene_111418

http://www.addgene.org/111418

Species: Mus musculus
Genetic Insert: murine Syk (C)SH2 domain plus interdomain A (Phe 119 to Gln 264), without any tag
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30051939
Comments: encoding the following protein sequence: MFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ

Proper citation: RRID:Addgene_111418 Copy   

    • RRID:Addgene_111419

http://www.addgene.org/111419

Species: Mus musculus
Genetic Insert: murine Syk (C)SH2 domain (His 162 to Gln 264), without any tag
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30051939
Comments: encoding the following protein sequence: MHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ

Proper citation: RRID:Addgene_111419 Copy   

http://www.addgene.org/111390

Species: Mus musculus
Genetic Insert: mCAR
Vector Backbone Description: Backbone Size:4115; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29879392

Proper citation: RRID:Addgene_111390 Copy   

http://www.addgene.org/111395

Species: Mus musculus
Genetic Insert: mCAR
Vector Backbone Description: Backbone Size:4825; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29879392

Proper citation: RRID:Addgene_111395 Copy   

http://www.addgene.org/100794

Species: Mus musculus
Genetic Insert: mouse-BNIP3_Exon(2+3)
Vector Backbone Description: Backbone Size:5400; Vector Backbone:pcDNA3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_100794 Copy   

    • RRID:Addgene_100796

    This resource has 1+ mentions.

http://www.addgene.org/100796

Species: Mus musculus
Genetic Insert: mus Bnip3
Vector Backbone Description: Backbone Size:5400; Vector Backbone:pcDNA3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26505960

Proper citation: RRID:Addgene_100796 Copy   

http://www.addgene.org/100869

Species: Mus musculus
Genetic Insert: Spdef
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pGFPC2; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28390865

Proper citation: RRID:Addgene_100869 Copy   

    • RRID:Addgene_100864

http://www.addgene.org/100864

Species: Mus musculus
Genetic Insert: Spdef
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pGFPC2; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28390865

Proper citation: RRID:Addgene_100864 Copy   

    • RRID:Addgene_100865

http://www.addgene.org/100865

Species: Mus musculus
Genetic Insert: Spdef
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pGFPC2; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28390865

Proper citation: RRID:Addgene_100865 Copy   

    • RRID:Addgene_100862

http://www.addgene.org/100862

Species: Mus musculus
Genetic Insert: Spdef
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pGFPC2; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28390865

Proper citation: RRID:Addgene_100862 Copy   

http://www.addgene.org/101157

Species: Mus musculus
Genetic Insert: SmyD1
Vector Backbone Description: Backbone Marker:System Biosciences; Vector Backbone:pCDH-EF1-MCS-T2A-copGFP; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28778067

Proper citation: RRID:Addgene_101157 Copy   

http://www.addgene.org/101285

Species: Mus musculus
Genetic Insert: E-Cadherin-GFP-H-Ras
Vector Backbone Description: Backbone Marker:J. Bear (UNC Chapel Hill, USA); Vector Backbone:LentiLox pLL5.0(backbone pLL3.7); Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24413434

Proper citation: RRID:Addgene_101285 Copy   

http://www.addgene.org/101282

Species: Mus musculus
Genetic Insert: E-cadherin
Vector Backbone Description: Vector Backbone:LentiLox pLL5.0(backbone pLL3.7); Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24413434

Proper citation: RRID:Addgene_101282 Copy   

    • RRID:Addgene_1015

    This resource has 50+ mentions.

http://www.addgene.org/1015

Species: Mus musculus
Genetic Insert: PPRE
Vector Backbone Description: Backbone Size:0; Vector Backbone:ptkLUC (modified?); Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9539737
Comments: 3xDR-1 response elements (AGGACAAAGGTCA) upstream of a luciferase reporter.

Proper citation: RRID:Addgene_1015 Copy   

    • RRID:Addgene_101734

    This resource has 1+ mentions.

http://www.addgene.org/101734

Species: Mus musculus
Genetic Insert: Atoh1
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24066662

Proper citation: RRID:Addgene_101734 Copy   

    • RRID:Addgene_101791

    This resource has 1+ mentions.

http://www.addgene.org/101791

Species: Mus musculus
Genetic Insert: Hri
Vector Backbone Description: Backbone Marker:Dr. Toshio Kitamura; Vector Backbone:pMXs-IP; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27633668

Proper citation: RRID:Addgene_101791 Copy   

    • RRID:Addgene_101793

    This resource has 1+ mentions.

http://www.addgene.org/101793

Species: Mus musculus
Genetic Insert: Perk
Vector Backbone Description: Backbone Marker:Dr. Toshio Kitamura; Vector Backbone:pMXs-IP; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27633668

Proper citation: RRID:Addgene_101793 Copy   

    • RRID:Addgene_101858

    This resource has 1+ mentions.

http://www.addgene.org/101858

Species: Mus musculus
Genetic Insert: Evi-1
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_101858 Copy   

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch