Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Organism:mus musculus (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

12,972 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pET-30a(+)-Syk-tSH2-PM
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_111271 murine Syk tandem SH2 domains (Ser 8 to Gln 264), with Y130E mutation to mimic phosphorylation Mus musculus Kanamycin PMID:26468009 encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREEVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin Y130E mutation to mimic phosphorylation 2026-08-15 01:01:48 1
pET-30a(+)-N-SH2+IA
 
Resource Report
Resource Website 		RRID:Addgene_111273 murine Syk (N)SH2 domain plus interdomain A (Ser 8 to His 162), with an N-terminal (His)6 tag and TEV cleavage site Mus musculus Kanamycin PMID:26468009 encoding the following protein sequence: MHHHHHHENLYFQGSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAH Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:48 0
pET-30a(+)-C-SH2+IA
 
Resource Report
Resource Website 		RRID:Addgene_111418 murine Syk (C)SH2 domain plus interdomain A (Phe 119 to Gln 264), without any tag Mus musculus Kanamycin PMID:30051939 encoding the following protein sequence: MFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:50 0
pET-30a(+)-C-SH2
 
Resource Report
Resource Website 		RRID:Addgene_111419 murine Syk (C)SH2 domain (His 162 to Gln 264), without any tag Mus musculus Kanamycin PMID:30051939 encoding the following protein sequence: MHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:50 0
pAAV-hSyn-DIO {mCAR}off-{ChETA-mRuby2}on-W3SL
 
Resource Report
Resource Website 		RRID:Addgene_111390 mCAR Mus musculus Ampicillin PMID:29879392 Backbone Size:4115; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin 2026-08-15 01:01:49 0
pAAV-hSyn-DIO {mCAR}off-{DTR-GFP}on-WPRE
 
Resource Report
Resource Website 		RRID:Addgene_111395 mCAR Mus musculus Ampicillin PMID:29879392 Backbone Size:4825; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin 2026-08-15 01:01:49 0
HA-mus-Bnip3_Exon(2+3)
 
Resource Report
Resource Website 		RRID:Addgene_100794 mouse-BNIP3_Exon(2+3) Mus musculus Ampicillin Backbone Size:5400; Vector Backbone:pcDNA3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin Exon2 and Exon3 deletion 2026-08-15 01:00:15 0
Myc-Bnip3FL
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_100796 mus Bnip3 Mus musculus Ampicillin PMID:26505960 Backbone Size:5400; Vector Backbone:pcDNA3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:00:15 7
pEGFP-mSPDEF deltaNC2
 
Resource Report
Resource Website 		RRID:Addgene_100869 Spdef Mus musculus Kanamycin PMID:28390865 Backbone Marker:Clontech; Vector Backbone:pGFPC2; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin truncated protein 70-238aa 2026-08-15 01:00:15 0
pEGFP-mSPDEF deltaN4
 
Resource Report
Resource Website 		RRID:Addgene_100864 Spdef Mus musculus Kanamycin PMID:28390865 Backbone Marker:Clontech; Vector Backbone:pGFPC2; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin truncated protein 85-325aa 2026-08-15 01:00:15 0
pEGFP-mSPDEF deltaN5
 
Resource Report
Resource Website 		RRID:Addgene_100865 Spdef Mus musculus Kanamycin PMID:28390865 Backbone Marker:Clontech; Vector Backbone:pGFPC2; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin truncated protein 100-325aa 2026-08-15 01:00:15 0
pEGFP-mSPDEF deltaN2
 
Resource Report
Resource Website 		RRID:Addgene_100862 Spdef Mus musculus Kanamycin PMID:28390865 Backbone Marker:Clontech; Vector Backbone:pGFPC2; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin truncated protein 55-325aa 2026-08-15 01:00:15 0
pCDH-EF1-mouse SmyD1-T2A-copGFP
 
Resource Report
Resource Website 		RRID:Addgene_101157 SmyD1 Mus musculus Ampicillin PMID:28778067 Backbone Marker:System Biosciences; Vector Backbone:pCDH-EF1-MCS-T2A-copGFP; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2026-08-15 01:00:17 0
pLL5.0 E-cadherin shRNA/E-cadherin GFP-IRES-HA-H-Ras V12
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_101285 E-Cadherin-GFP-H-Ras Mus musculus Ampicillin PMID:24413434 Backbone Marker:J. Bear (UNC Chapel Hill, USA); Vector Backbone:LentiLox pLL5.0(backbone pLL3.7); Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin H-Ras V12 2026-08-15 01:00:19 1
pLL5.0 E-cadherin shRNA/mE-cadherin-mCherry
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_101282 E-cadherin Mus musculus Ampicillin PMID:24413434 Vector Backbone:LentiLox pLL5.0(backbone pLL3.7); Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2026-08-15 01:00:18 1
PPRE X3-TK-luc
 
Resource Report
Resource Website
50+ mentions 		RRID:Addgene_1015 PPRE Mus musculus Ampicillin PMID:9539737 3xDR-1 response elements (AGGACAAAGGTCA) upstream of a luciferase reporter. Backbone Size:0; Vector Backbone:ptkLUC (modified?); Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin 2026-08-15 01:00:20 97
CMV-2xFLAG-Atoh1
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_101734 Atoh1 Mus musculus Ampicillin PMID:24066662 Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:00:21 2
pMXs-mHRI-FLAG-IP
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_101791 Hri Mus musculus Ampicillin PMID:27633668 Backbone Marker:Dr. Toshio Kitamura; Vector Backbone:pMXs-IP; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin 2026-08-15 01:00:21 1
pMXs-mPERK-FLAG-IP
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_101793 Perk Mus musculus Ampicillin PMID:27633668 Backbone Marker:Dr. Toshio Kitamura; Vector Backbone:pMXs-IP; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin 2026-08-15 01:00:21 2
pcDNA3.1-E-Flag
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_101858 Evi-1 Mus musculus Ampicillin Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:00:22 3

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch