Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 354 showing 7061 ~ 7080 out of 69,655 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_103890

http://www.addgene.org/103890

Species: Homo sapiens
Genetic Insert: MPDZ
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675

Proper citation: RRID:Addgene_103890 Copy   


  • RRID:Addgene_103896

http://www.addgene.org/103896

Species: Homo sapiens
Genetic Insert: MPDZ
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675

Proper citation: RRID:Addgene_103896 Copy   


  • RRID:Addgene_103931

http://www.addgene.org/103931

Species: Homo sapiens
Genetic Insert: MPP1
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675

Proper citation: RRID:Addgene_103931 Copy   


  • RRID:Addgene_103930

http://www.addgene.org/103930

Species: Homo sapiens
Genetic Insert: CYTIP
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675

Proper citation: RRID:Addgene_103930 Copy   


  • RRID:Addgene_103944

http://www.addgene.org/103944

Species: Homo sapiens
Genetic Insert: PDZK1
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675

Proper citation: RRID:Addgene_103944 Copy   


  • RRID:Addgene_103943

http://www.addgene.org/103943

Species: Homo sapiens
Genetic Insert: PDZK1
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675

Proper citation: RRID:Addgene_103943 Copy   


  • RRID:Addgene_103940

http://www.addgene.org/103940

Species: Homo sapiens
Genetic Insert: PDLIM7
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675

Proper citation: RRID:Addgene_103940 Copy   


  • RRID:Addgene_103941

http://www.addgene.org/103941

Species: Homo sapiens
Genetic Insert: PDLIM4
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675

Proper citation: RRID:Addgene_103941 Copy   


  • RRID:Addgene_104043

http://www.addgene.org/104043

Species: Homo sapiens
Genetic Insert: GATAD1 gRNA
Vector Backbone Description: Vector Backbone:PX458; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26355004
Comments: Note: This plasmid is part of the Mendenhall and Meyers CRISPR-based Tagging system to add a tag (currently using FLAG) to endogenous proteins. Please see https://www.addgene.org/crispr/tagging/ for more details.

Proper citation: RRID:Addgene_104043 Copy   


  • RRID:Addgene_103955

http://www.addgene.org/103955

Species: Homo sapiens
Genetic Insert: TJP2
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675

Proper citation: RRID:Addgene_103955 Copy   


  • RRID:Addgene_103956

http://www.addgene.org/103956

Species: Homo sapiens
Genetic Insert: APBA3
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675

Proper citation: RRID:Addgene_103956 Copy   


  • RRID:Addgene_103951

http://www.addgene.org/103951

Species: Homo sapiens
Genetic Insert: SNTB1
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675

Proper citation: RRID:Addgene_103951 Copy   


  • RRID:Addgene_103952

http://www.addgene.org/103952

Species: Homo sapiens
Genetic Insert: TIAM2
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675
Comments: Addgene NGS results found C982S in the TIAM2 translation compared to NP_036586.2.

Proper citation: RRID:Addgene_103952 Copy   


  • RRID:Addgene_103948

http://www.addgene.org/103948

Species: Homo sapiens
Genetic Insert: DLG3
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675
Comments: Addgene NGS results found R385H in the DLG3 translation compared to NP_066943.2

Proper citation: RRID:Addgene_103948 Copy   


  • RRID:Addgene_104200

http://www.addgene.org/104200

Species: Homo sapiens
Genetic Insert: human androgen receptor aa 624-919
Vector Backbone Description: Backbone Marker:Pharmacia; Backbone Size:4900; Vector Backbone:pGEX-5x-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12612084

Proper citation: RRID:Addgene_104200 Copy   


  • RRID:Addgene_104201

http://www.addgene.org/104201

Species: Homo sapiens
Genetic Insert: human androgen receptor aa 400-449
Vector Backbone Description: Backbone Marker:Pharmacia; Vector Backbone:pGEX-4T-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_104201 Copy   


http://www.addgene.org/104204

Species: Homo sapiens
Genetic Insert: NEDD4L WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PPPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDV

Proper citation: RRID:Addgene_104204 Copy   


http://www.addgene.org/104176

Species: Homo sapiens
Genetic Insert: CRY2low-tdTomato-Raf1
Vector Backbone Description: Backbone Size:4000; Vector Backbone:pmCherryN1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28916751

Proper citation: RRID:Addgene_104176 Copy   


  • RRID:Addgene_104154

    This resource has 1+ mentions.

http://www.addgene.org/104154

Species: Homo sapiens
Genetic Insert: ARHGAP29
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28538170

Proper citation: RRID:Addgene_104154 Copy   


http://www.addgene.org/104153

Species: Homo sapiens
Genetic Insert: hCRTmE6mE7mL2 11-210
Vector Backbone Description: Vector Backbone:pNGVL4a; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28515303

Proper citation: RRID:Addgene_104153 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X