Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: MPDZ
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675
Proper citation: RRID:Addgene_103890 Copy
Species: Homo sapiens
Genetic Insert: MPDZ
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675
Proper citation: RRID:Addgene_103896 Copy
Species: Homo sapiens
Genetic Insert: MPP1
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675
Proper citation: RRID:Addgene_103931 Copy
Species: Homo sapiens
Genetic Insert: CYTIP
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675
Proper citation: RRID:Addgene_103930 Copy
Species: Homo sapiens
Genetic Insert: PDZK1
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675
Proper citation: RRID:Addgene_103944 Copy
Species: Homo sapiens
Genetic Insert: PDZK1
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675
Proper citation: RRID:Addgene_103943 Copy
Species: Homo sapiens
Genetic Insert: PDLIM7
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675
Proper citation: RRID:Addgene_103940 Copy
Species: Homo sapiens
Genetic Insert: PDLIM4
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675
Proper citation: RRID:Addgene_103941 Copy
Species: Homo sapiens
Genetic Insert: GATAD1 gRNA
Vector Backbone Description: Vector Backbone:PX458; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26355004
Comments: Note: This plasmid is part of the Mendenhall and Meyers CRISPR-based Tagging system to add a tag (currently using FLAG) to endogenous proteins. Please see https://www.addgene.org/crispr/tagging/ for more details.
Proper citation: RRID:Addgene_104043 Copy
Species: Homo sapiens
Genetic Insert: TJP2
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675
Proper citation: RRID:Addgene_103955 Copy
Species: Homo sapiens
Genetic Insert: APBA3
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675
Proper citation: RRID:Addgene_103956 Copy
Species: Homo sapiens
Genetic Insert: SNTB1
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675
Proper citation: RRID:Addgene_103951 Copy
Species: Homo sapiens
Genetic Insert: TIAM2
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675
Comments: Addgene NGS results found C982S in the TIAM2 translation compared to NP_036586.2.
Proper citation: RRID:Addgene_103952 Copy
Species: Homo sapiens
Genetic Insert: DLG3
Vector Backbone Description: Backbone Size:4984; Vector Backbone:pGEX-6P-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:18828675
Comments: Addgene NGS results found R385H in the DLG3 translation compared to NP_066943.2
Proper citation: RRID:Addgene_103948 Copy
Species: Homo sapiens
Genetic Insert: human androgen receptor aa 624-919
Vector Backbone Description: Backbone Marker:Pharmacia; Backbone Size:4900; Vector Backbone:pGEX-5x-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12612084
Proper citation: RRID:Addgene_104200 Copy
Species: Homo sapiens
Genetic Insert: human androgen receptor aa 400-449
Vector Backbone Description: Backbone Marker:Pharmacia; Vector Backbone:pGEX-4T-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_104201 Copy
Species: Homo sapiens
Genetic Insert: NEDD4L WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PPPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDV
Proper citation: RRID:Addgene_104204 Copy
Species: Homo sapiens
Genetic Insert: CRY2low-tdTomato-Raf1
Vector Backbone Description: Backbone Size:4000; Vector Backbone:pmCherryN1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28916751
Proper citation: RRID:Addgene_104176 Copy
Species: Homo sapiens
Genetic Insert: ARHGAP29
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28538170
Proper citation: RRID:Addgene_104154 Copy
Species: Homo sapiens
Genetic Insert: hCRTmE6mE7mL2 11-210
Vector Backbone Description: Vector Backbone:pNGVL4a; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28515303
Proper citation: RRID:Addgene_104153 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
