Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Organism:homo sapiens (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

69,655 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
GST-AR-1-36
 
Resource Report
Resource Website 		RRID:Addgene_104192 human androgen receptor aa 1-36 Homo sapiens Ampicillin PMID:10816582 Backbone Marker:Pharmacia; Vector Backbone:pGEX-5x-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:00:42 0
GST-AR-1-173
 
Resource Report
Resource Website 		RRID:Addgene_104193 human androgen receptor aa 1-173 Homo sapiens Ampicillin PMID:10816582 The GST-AR insert contains an additional 4 glutamine residues at amino acid 74 compared to AAA51886.1 and the depositor has confirmed that this does not impact plasmid function. Backbone Marker:Pharmacia; Backbone Size:4900; Vector Backbone:pGEX-5x-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:00:40 0
GST-AR-4-52
 
Resource Report
Resource Website 		RRID:Addgene_104199 human androgen receptor aa 4-52 Homo sapiens Ampicillin PMID:15684378 Backbone Marker:Pharmacia; Vector Backbone:pGEX-4T-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:00:40 0
GST-AR-1-566
 
Resource Report
Resource Website 		RRID:Addgene_104195 human androgen receptor aa 1-566 Homo sapiens Ampicillin PMID:10816582 The GST-AR insert has an insertion of 3 glutamine residues at amino acid 74 and a deletion of six amino acids (GGGGGE) after amino acid 466 compared to the listed reference sequence. The depositor has confirmed that this should not affect plasmid function. Backbone Marker:Pharmacia; Backbone Size:4900; Vector Backbone:pGEX-5x-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:00:42 0
pHH0103 ARHGAP12 WW domain #2
 
Resource Report
Resource Website 		RRID:Addgene_104293 ARHGAP12 WW domain #2 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - TSDYTNEKWLKHVDDQGRQYYYSADGSRSEWELPKYNAS Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-08-15 01:00:41 0
pHH0103 KIAA0082 WW domain
 
Resource Report
Resource Website 		RRID:Addgene_104288 KIAA0082 WW domain Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - IVRTVNEPWTMGFSKSFKKKFFYNKKTKDSTFDLPADSI Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-08-15 01:00:41 0
pHH0103 PQBP1 WW domain
 
Resource Report
Resource Website 		RRID:Addgene_104287 PQBP1 WW domain Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - RLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPN Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-08-15 01:00:41 0
pHH0103 NEDD4 WW domain #1
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104208 NEDD4 WW domain #1 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - EPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDN Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-08-15 01:00:40 1
pHH0103 NEDD4L WW domain #4
 
Resource Report
Resource Website 		RRID:Addgene_104207 NEDD4L WW domain #4 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - DLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNP Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-08-15 01:00:40 0
pHH0103 NEDD4L WW domain #3
 
Resource Report
Resource Website 		RRID:Addgene_104206 NEDD4L WW domain #3 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - TQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFP Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-08-15 01:00:42 0
pHH0103 HLA-DQA2 WW domain
 
Resource Report
Resource Website 		RRID:Addgene_104297 HLA-DQA2 WW domain Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - QSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFI Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-08-15 01:00:41 0
pHH0103 ITCH WW domain #4
 
Resource Report
Resource Website 		RRID:Addgene_104219 ITCH WW domain #4 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - NEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKS Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-08-15 01:00:40 0
pHH0103 WWP2 WW domain #4
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104215 WWP2 WW domain #4 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - QEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFE Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-08-15 01:00:40 1
pHH0103 WWP2 WW domain #3
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104214 WWP2 WW domain #3 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMI Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-08-15 01:00:40 1
pHH0103 DRP2 WW domain
 
Resource Report
Resource Website 		RRID:Addgene_104270 DRP2 WW domain Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - LSSSVQVPWERAISPNKVPYYINHQAQTTCWDHPKMTEL Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-08-15 01:00:41 0
pHH0103 BAG3 WW domain
 
Resource Report
Resource Website 		RRID:Addgene_104266 BAG3 WW domain Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - DRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPS Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-08-15 01:00:43 0
pHH0103 CEP164 WW domain
 
Resource Report
Resource Website 		RRID:Addgene_104300 CEP164 WW domain Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - AAPGEWKPCQDITGDIYYFNFAHGQSMWDHPCDAAA Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-08-15 01:00:43 0
pHH0103 FNBP4 WW domain #2
 
Resource Report
Resource Website 		RRID:Addgene_104264 FNBP4 WW domain #2 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - EINATPKGWSCHWDRDHRRYFYVNEQSGESQWEFPDGEE Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-08-15 01:00:40 0
pGEX2TK-YAP-WW1-RRK
 
Resource Report
Resource Website 		RRID:Addgene_104306 YAP WW1 domain Homo sapiens Ampicillin The human WW domain in this plasmid was obtained from cDNA described in the following reference: Sudol M et al. J Biol Chem. 1995 Jun 16;270(24):14733-41. https://www.ncbi.nlm.nih.gov/pubmed/7782338 Please see the following references for additional information regarding the WW domain of human YAP: 1. Chen HI and Sudol M. Proc Natl Acad Sci U S A. 1995 Aug 15;92(17):7819-23. https://www.ncbi.nlm.nih.gov/pubmed/7644498 2. Toepert F et al., Angew Chem Int Ed Engl. 2001 Mar 2;40(5):897-900. https://www.ncbi.nlm.nih.gov/pubmed/11241639 Backbone Marker:Pharmacia; Vector Backbone:pGEX-2TK; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin WW domain 1 RRK mutant (TTAAATCACATCGATCAG to AGAAATAGAATCGATAAA) 2026-08-15 01:00:41 0
pHH0103 PIN1L WW domain
 
Resource Report
Resource Website 		RRID:Addgene_104269 PIN1L WW domain Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - DEEKLPPGWEKRMSRPSGRGYYFNHITNPSQWERPSGNS Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-08-15 01:00:43 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch