Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pTRIPZ Myc2-mouse TTP WT Resource Report Resource Website 1+ mentions |
RRID:Addgene_107000 | tristetraprolin | Mus musculus | Ampicillin | PMID:29246442 | Please note- Addgene's quality control found one “g” nucleotide missing from the insert sequence. The depositor noted this "g" should make no difference to the function of plasmid, since it is located within an intron and will be spliced out. | Backbone Marker:Thermo Scientific; Vector Backbone:pTRIPZ; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:05 | 1 | |
|
pET21d-colEdes13/Imdes13 Resource Report Resource Website |
RRID:Addgene_107121 | colEdes13/Imdes13 | Synthetic | Ampicillin | PMID:30538236 | Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes13: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWEEVSKDPDLSKQFKRSNQNNIKQGIAPFARSKDQVGGRRTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes13: MELKHSISDYTEAEFLEFVKKIMASNDETQQRKLVTEFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH | Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:08 | 0 | |
|
pET15T-MsePCNA1 Resource Report Resource Website |
RRID:Addgene_107063 | M. sedula PCNA1 | Synthetic | Ampicillin | PMID:27228945 | Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:06 | 0 | ||
|
pUDP046 Resource Report Resource Website |
RRID:Addgene_107062 | HH-gRNA-HDV targetting OpKU80 inO. parapolymorpha | Ogataea parapolymorpha | Ampicillin | PMID:29438517 | Backbone Marker:Juergens H et al. Genome editing in Kluyveromyces and Ogataea yeasts using a broad-host-range Cas9/gRNA expression plasmid; Backbone Size:10046; Vector Backbone:pUDP002 #103872; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:08 | 0 | ||
|
pGC1::YC3.60 Resource Report Resource Website |
RRID:Addgene_107061 | YC3.6 | Synthetic | Kanamycin | PMID:18284694 | Vector Backbone:pGreenII 0179; Vector Types:Plant Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:01:06 | 0 | ||
|
K785R Smarca4-sfGFP Resource Report Resource Website |
RRID:Addgene_107057 | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 | Mus musculus | Ampicillin | PMID:29323272 | Vector Backbone:pRRL; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | K785R | 2026-08-15 01:01:06 | 0 | |
|
pX601 miniCMV-SaCas9-SpA-sgRNA scaffold Resource Report Resource Website 1+ mentions |
RRID:Addgene_107055 | Ampicillin | Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:06 | 5 | |||||
|
pMD-MsePCNA3 Resource Report Resource Website |
RRID:Addgene_107075 | M. sedula PCNA3 | Synthetic | Ampicillin | PMID:27228945 | Backbone Marker:Takara Bio; Backbone Size:2700; Vector Backbone:pMD20; Vector Types:Cloning vector; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:06 | 0 | ||
|
pMD-MsePCNA2 Resource Report Resource Website |
RRID:Addgene_107074 | M. sedula PCNA2 | Synthetic | Ampicillin | PMID:27228945 | Backbone Marker:Takara Bio; Backbone Size:2700; Vector Backbone:pMD20; Vector Types:Cloning vector; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:08 | 0 | ||
|
pMD-MsePCNA1 Resource Report Resource Website |
RRID:Addgene_107073 | M. sedula PCNA1 | Synthetic | Ampicillin | PMID:27228945 | Backbone Marker:Takara Bio; Backbone Size:2700; Vector Backbone:pMD20; Vector Types:Cloning vector; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:06 | 0 | ||
|
pET15b-YC Resource Report Resource Website |
RRID:Addgene_107072 | YPet-CyPet fusion protein | Synthetic | Ampicillin | PMID:27228945 | Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:06 | 0 | ||
|
pET28b-MseLig1 Resource Report Resource Website |
RRID:Addgene_107071 | DNA ligase 1 | Synthetic | Kanamycin | PMID:27228945 | Backbone Marker:Merck Millipore; Backbone Size:5400; Vector Backbone:pET-28b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:01:08 | 0 | ||
|
pLJM60 FLAG-RAB35 S22N Resource Report Resource Website |
RRID:Addgene_107106 | RAB35 | Homo sapiens | Ampicillin | PMID:26338797 | Backbone Marker:Sabatini lab; Vector Backbone:pLJM60; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:06 | 0 | ||
|
pLJM60 FLAG-RAB35 Q67L Resource Report Resource Website |
RRID:Addgene_107105 | RAB35 | Homo sapiens | Ampicillin | PMID:26338797 | Backbone Marker:Sabatini lab; Vector Backbone:pLJM60; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | Q67L | 2026-08-15 01:01:08 | 0 | |
|
pMAL-SsoPCNA3 Resource Report Resource Website |
RRID:Addgene_107069 | S. solfataricus PCNA3 | Synthetic | Ampicillin | PMID:27228945 | Backbone Marker:New England Biolabs; Backbone Size:5670; Vector Backbone:pMAL-c5E; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:06 | 0 | ||
|
pET21d-colEdes2/Imdes2 Resource Report Resource Website |
RRID:Addgene_107109 | colEdes2/Imdes2 | Synthetic | Ampicillin | PMID:30538236 | Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes2: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWKEVAKDPDLAKQFKRANRRNIKQGRAPFAPKKDQVGGRRTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes2: MELKHSISDYTEAEFLEFVKKIYNSTDEEKQKELVTEFERLTEHPSGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH | Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:06 | 0 | |
|
pGEX-6P-3-F37A+L196F+V252A+C253G-hADPRM Resource Report Resource Website |
RRID:Addgene_107163 | F37A+L196F+V252A+C253G-hADPRM GST-mutant cADPR phosphohydrolase gene | Synthetic | Ampicillin | PMID:29348648 | Backbone Marker:GE Healthcare; Backbone Size:4946; Vector Backbone:pGEX-6P-3; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:09 | 0 | ||
|
pBHt2G-RFP Resource Report Resource Website |
RRID:Addgene_107162 | Ampicillin | Golden-Gate compatible Magnaporthe oryzae Agrobacterium transformation vectors. Pennington HG, Youles M, Kamoun S. Figshare (2018) 10.6084/m9.figshare.5808348 | Backbone Marker:Khang et al, 2010 http://www.plantcell.org/content/22/4/1388; Backbone Size:9617; Vector Backbone:pBHt2G; Vector Types:Fungal grobacterium transformation plasmid, tested in Magnaporthe; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:07 | 0 | ||||
|
Flag-hPKL S113D Resource Report Resource Website |
RRID:Addgene_107161 | Flag-hPKL S113D | Homo sapiens | Ampicillin | PMID:31825824 | Backbone Marker:Clontech; Backbone Size:6819; Vector Backbone:pLHCX; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | Serine 113 mutated to aspartate | 2026-08-15 01:01:07 | 0 | |
|
Flag-hPKL WT Resource Report Resource Website |
RRID:Addgene_107159 | Flag-hPKL WT | Homo sapiens | Ampicillin | PMID:31825824 | Backbone Marker:Clontech; Backbone Size:6819; Vector Backbone:pLHCX; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:07 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.