Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 357 showing 7121 ~ 7140 out of 69,655 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection

http://www.addgene.org/104238

Species: Homo sapiens
Genetic Insert: SMURF1 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - ELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHI

Proper citation: RRID:Addgene_104238 Copy   


  • RRID:Addgene_104481

http://www.addgene.org/104481

Species: Homo sapiens
Genetic Insert: TDP-43
Vector Backbone Description: Vector Backbone:pJ4M; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29438978

Proper citation: RRID:Addgene_104481 Copy   


  • RRID:Addgene_104402

    This resource has 1+ mentions.

http://www.addgene.org/104402

Species: Homo sapiens
Genetic Insert: CD9
Vector Backbone Description: Backbone Marker:Thermo Fisher; Backbone Size:9351; Vector Backbone:pLenti6.3/TO/V5-DEST; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29221804
Comments: Plasmid is used and named CD9-GFP in publication even though it contains mEmerald. Described in the methods of Boker et al 2018 (https://www.ncbi.nlm.nih.gov/pubmed/29221804). Please see publication for more information. Also see the following article for additional information on using this plasmid: Schiller et al., 2018 https://www.sciencedirect.com/science/article/pii/S2329050118300378

Proper citation: RRID:Addgene_104402 Copy   


  • RRID:Addgene_104465

http://www.addgene.org/104465

Species: Homo sapiens
Genetic Insert: hnRNPA2
Vector Backbone Description: Vector Backbone:pJ411; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29358076

Proper citation: RRID:Addgene_104465 Copy   


  • RRID:Addgene_104468

http://www.addgene.org/104468

Species: Homo sapiens
Genetic Insert: hnRNPA2
Vector Backbone Description: Vector Backbone:pTHMT; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29358076

Proper citation: RRID:Addgene_104468 Copy   


http://www.addgene.org/104467

Species: Homo sapiens
Genetic Insert: hnRNPA2
Vector Backbone Description: Vector Backbone:pTHMT; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29358076

Proper citation: RRID:Addgene_104467 Copy   


  • RRID:Addgene_104349

http://www.addgene.org/104349

Species: Homo sapiens
Genetic Insert: CD95L leucine zipper
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1(-); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32706785
Comments: Synthetic DNA encoding a fusion of an improved IL2 signal sequence (Zhang et al. 2005 & Naito et al. 2013), an octahistidine-tagged-leucine zipper motif, a flexible 17aa linker (Naito et al. 2013) and the death inducing, c-terminal extracellular domain (aa137-208) of CD95L. The cloning strategy omits the proteolytically-susceptible extracellular stalk region (aa102-136), but includes the extracellular self-assembly domain (aa137-183; Orlinick et al. 1997). NTA column purified LZ-CD95L produced in expi393 cells is highly active (IC50 Jurkat E6-1 cells < 50ng/ml). Human CD95L is also active in inducing cell death in murine thymocytes (McLellan et al. 2000). Note, during following transient transfection, rising levels of LZ-CD95L in the culture supernatant induce cell death in HEK293FT and expi293. Users could explore co-transfection of this vector with a c-FLIP-encoding vector, select CD95L resistant HEK293 variants, or use other CD95L-resistant mammalian cell lines to maximise LZ-CD95L yields. References: McLellan AD, Terbeck G, Mengling T, Starling GC, Kiener PA, Gold R, Bröcker EB, Leverkus M, Kämpgen E. Differential susceptibility to CD95 (Apo-1/Fas) and MHC class II-induced apoptosis during murine dendritic cell development. Cell Death Differ. 2000 Oct;7(10):933-8. Naito M, Hainz U, Burkhardt UE, Fu B, Ahove D, Stevenson KE, Rajasagi M, Zhu B, Alonso A, Witten E, Matsuoka K, Neuberg D, Duke-Cohan JS, Wu CJ, and Freeman GJ. CD40L-Tri, a novel formulation of recombinant human CD40L that effectively activates B cells. Cancer Immunol Immunother 2013; 62:347-357. Orlinick JR, Elkon KB, and Chao MV. Separate domains of the human fas ligand dictate self-association and receptor binding. J Biol Chem 1997; 272:32221-32229. Zhang L, Leng Q, and Mixson AJ. Alteration in the IL-2 signal peptide affects secretion of proteins in vitro and in vivo. The Journal of Gene Medicine 2005; 7:354-365.

Proper citation: RRID:Addgene_104349 Copy   


  • RRID:Addgene_104348

http://www.addgene.org/104348

Species: Homo sapiens
Genetic Insert: Human IL-2 (C125S)
Vector Backbone Description: Backbone Marker:qIAGEN; Backbone Size:4751; Vector Backbone:pQE80L; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Like the FDA approved Proleukin (Aldesleukin), the sequence contains a C125S mutation (TGT -> TCC) to prevent cysteine mispairing in E. coli, but this does not affect biological activity (Wang et al. 1984) Expression and inclusion body preparation was carried out essentially as described in Carmenate et al. (2013), except that the 6M guanidine solubilised IL-2 was applied directly to an NTA column at 1 column volume / minute. LPS was removed with 0.1% Triton X114 / TE washes following by on-column re-folding with TE buffer. NTA-purified His-IL-2 exhibited identical activity to commercially sourced (tag-free) IL-2 (Peprotech). References: Wang A, Lu SD, and Mark DF. Site-specific mutagenesis of the human interleukin-2 gene: structure-function analysis of the cysteine residues. Science 1984; 224:1431-1433. Carmenate T, Pacios A, Enamorado M, Moreno E, Garcia-Martinez K, Fuente D, and Leon K. Human IL-2 mutein with higher antitumor efficacy than wild type IL-2. J. Immunol. 2013; 190:6230-6238.

Proper citation: RRID:Addgene_104348 Copy   


  • RRID:Addgene_104480

    This resource has 10+ mentions.

http://www.addgene.org/104480

Species: Homo sapiens
Genetic Insert: TDP-43
Vector Backbone Description: Vector Backbone:pJ4M; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29438978

Proper citation: RRID:Addgene_104480 Copy   


http://www.addgene.org/104476

Species: Homo sapiens
Genetic Insert: FRBx2
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:2958; Vector Backbone:pBlueScript KS (-); Vector Types:phagemid; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26709839

Proper citation: RRID:Addgene_104476 Copy   


http://www.addgene.org/104470

Species: Homo sapiens
Genetic Insert: hnRNPA2
Vector Backbone Description: Vector Backbone:pJ411; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29358076

Proper citation: RRID:Addgene_104470 Copy   


  • RRID:Addgene_104479

http://www.addgene.org/104479

Species: Homo sapiens
Genetic Insert: TDP-43
Vector Backbone Description: Vector Backbone:pJ411; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29438978

Proper citation: RRID:Addgene_104479 Copy   


  • RRID:Addgene_104542

    This resource has 1+ mentions.

http://www.addgene.org/104542

Species: Homo sapiens
Genetic Insert: MYCN proto-oncogene, bHLH transcription factor
Vector Backbone Description: Vector Backbone:PiggyBac; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29320761

Proper citation: RRID:Addgene_104542 Copy   


  • RRID:Addgene_104583

    This resource has 1+ mentions.

http://www.addgene.org/104583

Species: Homo sapiens
Genetic Insert: Human IgG1 CH1/CH2/CH3
Vector Backbone Description: Backbone Marker:Invitrogen (Thermo Fisher); Backbone Size:10143; Vector Backbone:pCEP4; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30196504
Comments: Addgene NGS results found A169G, A261G, A292G, and A295G within the EBNA1 translation on the pCEP4 backbone compared to YP_401677.1

Proper citation: RRID:Addgene_104583 Copy   


http://www.addgene.org/104629

Species: Homo sapiens
Genetic Insert: Caspase-3
Vector Backbone Description: Backbone Marker:Scott Gradia (Addgene plasmid # 29653); Vector Backbone:pET His6 TEV LIC cloning vector; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28893998
Comments: LOV2 domain was inserted into the intersubunit linker of the caspase, with linker variation N7C-7

Proper citation: RRID:Addgene_104629 Copy   


http://www.addgene.org/104628

Species: Homo sapiens
Genetic Insert: Caspase-3
Vector Backbone Description: Backbone Marker:Scott Gradia (Addgene plasmid # 29653); Vector Backbone:pET His6 TEV LIC cloning vector; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28893998
Comments: Please note that during Addgene's quality control process 2 mismatches were found in lacI which result in mutations S219F and Q311P. LOV2 domain was inserted into the intersubunit linker of the caspase, with linker variation N7C-7 and mutation C450A, which is a dark-locked and light-insensitive mutation

Proper citation: RRID:Addgene_104628 Copy   


  • RRID:Addgene_104848

http://www.addgene.org/104848

Species: Homo sapiens
Genetic Insert: major histocompatibility complex, class I, B
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pMP71; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_104848 Copy   


  • RRID:Addgene_104850

    This resource has 1+ mentions.

http://www.addgene.org/104850

Species: Homo sapiens
Genetic Insert: major histocompatibility complex, class I, B
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pMP71; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31022685

Proper citation: RRID:Addgene_104850 Copy   


  • RRID:Addgene_104837

http://www.addgene.org/104837

Species: Homo sapiens
Genetic Insert: major histocompatibility complex, class I, B
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:2580; Vector Backbone:pENTR; Vector Types:entry vector for Gateway system; Bacterial Resistance:Kanamycin

Proper citation: RRID:Addgene_104837 Copy   


  • RRID:Addgene_104973

    This resource has 1+ mentions.

http://www.addgene.org/104973

Species: Homo sapiens
Genetic Insert: Tripartite Motif containing 21
Vector Backbone Description: Backbone Marker:Mark Allen (MRC LMB); Backbone Size:3113; Vector Backbone:HLTV; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29153837

Proper citation: RRID:Addgene_104973 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X