Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Synthetic
Genetic Insert: SpyTag003-sfCherry11-tagBFP-6xHIS
Vector Backbone Description: Vector Backbone:pET-28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35618485
Comments: Please visit https://www.biorxiv.org/content/10.1101/2022.04.04.487023v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_186905 Copy
Species: A. victoria
Genetic Insert: EGFP
Vector Backbone Description: Backbone Marker:Alexeyev lab; Backbone Size:4064; Vector Backbone:pMA2008; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35883613
Proper citation: RRID:Addgene_184849 Copy
Species: Rattus norvegicus
Genetic Insert: rat KIF5C
Vector Backbone Description: Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35504282
Proper citation: RRID:Addgene_188071 Copy
Species: Rattus norvegicus
Genetic Insert: rat KIF5C
Vector Backbone Description: Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35504282
Proper citation: RRID:Addgene_188072 Copy
Species: Drosophila melanogaster
Genetic Insert: DmDCP1_328-366
Vector Backbone Description: Vector Backbone:Unknown; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:19966221
Comments: Plasmids from this collection were made available to the research community and donated after the lab closed. Please note that the sequence provided by the depositing laboratory may be theoretical/predicted or based on Sanger sequencing results. There may be discrepancies between sequencing results obtained by Addgene and the depositor sequence. If an Addgene verified sequence is not available, please contact [email protected] before placing your order to request that our lab fully sequence the plasmid.
Proper citation: RRID:Addgene_146406 Copy
Species: Drosophila melanogaster
Genetic Insert: DmDCP1_328-366-mut3
Vector Backbone Description: Vector Backbone:Unknown; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:19966221
Comments: Plasmids from this collection were made available to the research community and donated after the lab closed. Please note that the sequence provided by the depositing laboratory may be theoretical/predicted or based on Sanger sequencing results. There may be discrepancies between sequencing results obtained by Addgene and the depositor sequence. If an Addgene verified sequence is not available, please contact [email protected] before placing your order to request that our lab fully sequence the plasmid.
Proper citation: RRID:Addgene_146405 Copy
Species: Drosophila melanogaster
Genetic Insert: DmDCP1_328-366-mut2
Vector Backbone Description: Vector Backbone:Unknown; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:19966221
Comments: Plasmids from this collection were made available to the research community and donated after the lab closed. Please note that the sequence provided by the depositing laboratory may be theoretical/predicted or based on Sanger sequencing results. There may be discrepancies between sequencing results obtained by Addgene and the depositor sequence. If an Addgene verified sequence is not available, please contact [email protected] before placing your order to request that our lab fully sequence the plasmid.
Proper citation: RRID:Addgene_146404 Copy
Species: Homo sapiens
Genetic Insert: ppih
Vector Backbone Description: Vector Backbone:pET28GST-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28935721
Comments: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPRGSMAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDALDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
Proper citation: RRID:Addgene_137655 Copy
Species: Other
Genetic Insert: sgRNA
Vector Backbone Description: Vector Backbone:pTRV2 (SPDK3888); Vector Types:CRISPR, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:36088516
Proper citation: RRID:Addgene_185629 Copy
Vector Backbone Description: Vector Backbone:pCA; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32161816
Proper citation: RRID:Addgene_187543 Copy
Vector Backbone Description: Vector Backbone:pCO; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32161816
Proper citation: RRID:Addgene_187549 Copy
Species: Drosophila melanogaster
Genetic Insert: DmXRN1_1323-1383-DmDCP1_1-127
Vector Backbone Description: Vector Backbone:Unknown; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:23142987
Comments: Plasmids from this collection were made available to the research community and donated after the lab closed. Please note that the sequence provided by the depositing laboratory may be theoretical/predicted or based on Sanger sequencing results. There may be discrepancies between sequencing results obtained by Addgene and the depositor sequence. If an Addgene verified sequence is not available, please contact [email protected] before placing your order to request that our lab fully sequence the plasmid.
Proper citation: RRID:Addgene_147056 Copy
Species: Drosophila melanogaster
Genetic Insert: DmXRN1_1323-1355-L1323AQ1326A-DmDCP1_1-127
Vector Backbone Description: Vector Backbone:Unknown; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:23142987
Comments: Plasmids from this collection were made available to the research community and donated after the lab closed. Please note that the sequence provided by the depositing laboratory may be theoretical/predicted or based on Sanger sequencing results. There may be discrepancies between sequencing results obtained by Addgene and the depositor sequence. If an Addgene verified sequence is not available, please contact [email protected] before placing your order to request that our lab fully sequence the plasmid.
Proper citation: RRID:Addgene_147220 Copy
Genetic Insert: 3X YY1 motif
Vector Backbone Description: Vector Backbone:pBait; Vector Types:Unspecified; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35927480
Proper citation: RRID:Addgene_165147 Copy
Species: Oryza sativa
Genetic Insert: OsaHIP34
Vector Backbone Description: Vector Backbone:pGBKT7; Vector Types:Yeast Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34758051
Proper citation: RRID:Addgene_168396 Copy
Species: Oryza sativa
Genetic Insert: OsaHIP24
Vector Backbone Description: Vector Backbone:pGBKT7; Vector Types:Yeast Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34758051
Proper citation: RRID:Addgene_168397 Copy
Species: Homo sapiens
Genetic Insert: Plekhh1-CTer
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4728; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34723325
Proper citation: RRID:Addgene_187369 Copy
Species: Homo sapiens
Genetic Insert: Plekhh1-NTer
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4728; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34723325
Proper citation: RRID:Addgene_187368 Copy
Species: Rattus norvegicus
Genetic Insert: myosin 1b isoform b Tail domain
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4713; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26195670
Comments: PCR cloning at BglII-SalI DNA fragment was generated by PCR on rat Myo1b cDNA with 5' primer TTGGCCATCAAGACCTTACCTA and 3' primer CCTCACTTAAGGGACAGCGACTT
Proper citation: RRID:Addgene_187365 Copy
Species: Rattus norvegicus
Genetic Insert: myosin 1b isoform b IQTail domain
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4743; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:10233157
Comments: The expression of the recombinant plasmid includes the addition of 18 amino acids (SGLRSRAQASNSDPRYPP) between GFP and Myo1b. Cloning by deletion of the fragment EcoRV-EcoRV from the recombinant plasmid encoding GFP-Myo1b.
Proper citation: RRID:Addgene_187363 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
