Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Bacterial Resistance:kanamycin (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

33,912 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pEGFPC2-gephyrin C3
 
Resource Report
Resource Website 		RRID:Addgene_199610 Gephyrin Rattus norvegicus Kanamycin PMID:36314779 Gephyrin C3 cassette encodes NHPFYTSPAVFMANHGQPIPGLISYSHHATGSADKR after K243 (Thought to be expressed in astrocytes for MoCo biosynthesis and prevents olgomerization of gephyrin molecules for synapse scaffolding function in neurons) Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFPC2; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin C3 cassette insertion 2026-08-15 01:26:23 0
pMYT082
 
Resource Report
Resource Website 		RRID:Addgene_198864 Kanamycin PMID:37930278 Backbone Marker:John Dueber; Vector Backbone:pYTK090; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:26:22 0
pMYT092
 
Resource Report
Resource Website 		RRID:Addgene_198865 Int.8 Spacer Synthetic Kanamycin PMID:37930278 Backbone Marker:John Dueber; Vector Backbone:pYTK090; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:26:24 0
pET28-sfGFP[N150TAA]
 
Resource Report
Resource Website 		RRID:Addgene_164581 sfGFP-150TAA Other Kanamycin PMID:34590824 Production of full-length protein requires TAA suppression machinery. Please visit https://doi.org/10.1101/2021.04.12.439361 for bioRxiv preprint. Backbone Size:5205; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin N150TAA Mutation 2026-08-15 01:26:24 0
pBUE411-B
 
Resource Report
Resource Website 		RRID:Addgene_198234 pPLTP::BBM cassette Zea mays; Agrobacterium tumefaciens Kanamycin Please visit https://www.biorxiv.org/content/10.1101/2022.09.02.506370v1 for bioRxiv preprint. Backbone Size:6500; Vector Backbone:pBUE411; Vector Types:Plant Expression, CRISPR, plant binary vector; Bacterial Resistance:Kanamycin 2026-08-15 01:26:28 0
pEM.P04R
 
Resource Report
Resource Website 		RRID:Addgene_198648 pTPI1 Saccharomyces cerevisiae Kanamycin PMID:37058502 Cloning Method: Goldon Gate Assembly Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:26:27 0
pEM.P05L
 
Resource Report
Resource Website 		RRID:Addgene_198649 pCYC1 Saccharomyces cerevisiae Kanamycin PMID:37058502 Cloning Method: Goldon Gate Assembly Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:26:27 0
pEM.P03R
 
Resource Report
Resource Website 		RRID:Addgene_198646 pPGK1 Saccharomyces cerevisiae Kanamycin PMID:37058502 Cloning Method: Goldon Gate Assembly Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:26:27 0
pEM.P04L
 
Resource Report
Resource Website 		RRID:Addgene_198647 pTPI1 Saccharomyces cerevisiae Kanamycin PMID:37058502 Cloning Method: Goldon Gate Assembly Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:26:30 0
pEM.P02R
 
Resource Report
Resource Website 		RRID:Addgene_198644 pENO2 Saccharomyces cerevisiae Kanamycin PMID:37058502 Cloning Method: Goldon Gate Assembly Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:26:30 0
pEM.P01R
 
Resource Report
Resource Website 		RRID:Addgene_198642 pTDH3 Saccharomyces cerevisiae Kanamycin PMID:37058502 Cloning Method: Goldon Gate Assembly Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:26:27 0
gRNA NIA TLS1
 
Resource Report
Resource Website 		RRID:Addgene_196980 AtNIA1 gRNAs fused to TLS1 tags Arabidopsis thaliana Kanamycin PMID:36593415 Please refer to the GO CRISP Cloning Protocol linked above for additional information. Vector Backbone:pMDC100; Vector Types:Plant Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:26:29 0
pEM.F01L
 
Resource Report
Resource Website 		RRID:Addgene_198659 GFP Other Kanamycin PMID:37058502 Cloning Method: Goldon Gate Assembly Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:26:30 0
pEM.A02L
 
Resource Report
Resource Website 		RRID:Addgene_198657 Adaptor Synthetic Kanamycin PMID:37058502 Cloning Method: Goldon Gate Assembly Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:26:28 0
pEM.A02R
 
Resource Report
Resource Website 		RRID:Addgene_198658 Adaptor Synthetic Kanamycin PMID:37058502 Cloning Method: Goldon Gate Assembly Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:26:28 0
pEGFP-C1-G2BRSCR
 
Resource Report
Resource Website 		RRID:Addgene_185345 scrambled gp78 G2BR sequence Synthetic Kanamycin PMID:34879065 Encodes a scrambled gp78 G2BR sequence: SKANDSRELQFRKMRLRAQRQVQELDKL Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin scrambled sequence 2026-08-15 01:26:29 0
pEM.A01L
 
Resource Report
Resource Website 		RRID:Addgene_198655 Adaptor Synthetic Kanamycin PMID:37058502 Cloning Method: Goldon Gate Assembly Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:26:27 0
pEM.T01L
 
Resource Report
Resource Website 		RRID:Addgene_198653 tADH1 Saccharomyces cerevisiae Kanamycin PMID:37058502 Cloning Method: Goldon Gate Assembly Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:26:30 0
pEM.T02R
 
Resource Report
Resource Website 		RRID:Addgene_198654 tCYC1 Saccharomyces cerevisiae Kanamycin PMID:37058502 Cloning Method: Goldon Gate Assembly Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:26:27 0
pEM.P06L
 
Resource Report
Resource Website 		RRID:Addgene_198651 pPDA1 Saccharomyces cerevisiae Kanamycin PMID:37058502 Cloning Method: Goldon Gate Assembly Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-15 01:26:27 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch