Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pEGFPC2-gephyrin C3 Resource Report Resource Website |
RRID:Addgene_199610 | Gephyrin | Rattus norvegicus | Kanamycin | PMID:36314779 | Gephyrin C3 cassette encodes NHPFYTSPAVFMANHGQPIPGLISYSHHATGSADKR after K243 (Thought to be expressed in astrocytes for MoCo biosynthesis and prevents olgomerization of gephyrin molecules for synapse scaffolding function in neurons) | Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFPC2; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | C3 cassette insertion | 2026-08-15 01:26:23 | 0 |
|
pMYT082 Resource Report Resource Website |
RRID:Addgene_198864 | Kanamycin | PMID:37930278 | Backbone Marker:John Dueber; Vector Backbone:pYTK090; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:22 | 0 | ||||
|
pMYT092 Resource Report Resource Website |
RRID:Addgene_198865 | Int.8 Spacer | Synthetic | Kanamycin | PMID:37930278 | Backbone Marker:John Dueber; Vector Backbone:pYTK090; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:24 | 0 | ||
|
pET28-sfGFP[N150TAA] Resource Report Resource Website |
RRID:Addgene_164581 | sfGFP-150TAA | Other | Kanamycin | PMID:34590824 | Production of full-length protein requires TAA suppression machinery. Please visit https://doi.org/10.1101/2021.04.12.439361 for bioRxiv preprint. | Backbone Size:5205; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | N150TAA Mutation | 2026-08-15 01:26:24 | 0 |
|
pBUE411-B Resource Report Resource Website |
RRID:Addgene_198234 | pPLTP::BBM cassette | Zea mays; Agrobacterium tumefaciens | Kanamycin | Please visit https://www.biorxiv.org/content/10.1101/2022.09.02.506370v1 for bioRxiv preprint. | Backbone Size:6500; Vector Backbone:pBUE411; Vector Types:Plant Expression, CRISPR, plant binary vector; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:28 | 0 | ||
|
pEM.P04R Resource Report Resource Website |
RRID:Addgene_198648 | pTPI1 | Saccharomyces cerevisiae | Kanamycin | PMID:37058502 | Cloning Method: Goldon Gate Assembly | Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:27 | 0 | |
|
pEM.P05L Resource Report Resource Website |
RRID:Addgene_198649 | pCYC1 | Saccharomyces cerevisiae | Kanamycin | PMID:37058502 | Cloning Method: Goldon Gate Assembly | Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:27 | 0 | |
|
pEM.P03R Resource Report Resource Website |
RRID:Addgene_198646 | pPGK1 | Saccharomyces cerevisiae | Kanamycin | PMID:37058502 | Cloning Method: Goldon Gate Assembly | Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:27 | 0 | |
|
pEM.P04L Resource Report Resource Website |
RRID:Addgene_198647 | pTPI1 | Saccharomyces cerevisiae | Kanamycin | PMID:37058502 | Cloning Method: Goldon Gate Assembly | Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:30 | 0 | |
|
pEM.P02R Resource Report Resource Website |
RRID:Addgene_198644 | pENO2 | Saccharomyces cerevisiae | Kanamycin | PMID:37058502 | Cloning Method: Goldon Gate Assembly | Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:30 | 0 | |
|
pEM.P01R Resource Report Resource Website |
RRID:Addgene_198642 | pTDH3 | Saccharomyces cerevisiae | Kanamycin | PMID:37058502 | Cloning Method: Goldon Gate Assembly | Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:27 | 0 | |
|
gRNA NIA TLS1 Resource Report Resource Website |
RRID:Addgene_196980 | AtNIA1 gRNAs fused to TLS1 tags | Arabidopsis thaliana | Kanamycin | PMID:36593415 | Please refer to the GO CRISP Cloning Protocol linked above for additional information. | Vector Backbone:pMDC100; Vector Types:Plant Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:29 | 0 | |
|
pEM.F01L Resource Report Resource Website |
RRID:Addgene_198659 | GFP | Other | Kanamycin | PMID:37058502 | Cloning Method: Goldon Gate Assembly | Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:30 | 0 | |
|
pEM.A02L Resource Report Resource Website |
RRID:Addgene_198657 | Adaptor | Synthetic | Kanamycin | PMID:37058502 | Cloning Method: Goldon Gate Assembly | Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:28 | 0 | |
|
pEM.A02R Resource Report Resource Website |
RRID:Addgene_198658 | Adaptor | Synthetic | Kanamycin | PMID:37058502 | Cloning Method: Goldon Gate Assembly | Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:28 | 0 | |
|
pEGFP-C1-G2BRSCR Resource Report Resource Website |
RRID:Addgene_185345 | scrambled gp78 G2BR sequence | Synthetic | Kanamycin | PMID:34879065 | Encodes a scrambled gp78 G2BR sequence: SKANDSRELQFRKMRLRAQRQVQELDKL | Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | scrambled sequence | 2026-08-15 01:26:29 | 0 |
|
pEM.A01L Resource Report Resource Website |
RRID:Addgene_198655 | Adaptor | Synthetic | Kanamycin | PMID:37058502 | Cloning Method: Goldon Gate Assembly | Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:27 | 0 | |
|
pEM.T01L Resource Report Resource Website |
RRID:Addgene_198653 | tADH1 | Saccharomyces cerevisiae | Kanamycin | PMID:37058502 | Cloning Method: Goldon Gate Assembly | Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:30 | 0 | |
|
pEM.T02R Resource Report Resource Website |
RRID:Addgene_198654 | tCYC1 | Saccharomyces cerevisiae | Kanamycin | PMID:37058502 | Cloning Method: Goldon Gate Assembly | Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:27 | 0 | |
|
pEM.P06L Resource Report Resource Website |
RRID:Addgene_198651 | pPDA1 | Saccharomyces cerevisiae | Kanamycin | PMID:37058502 | Cloning Method: Goldon Gate Assembly | Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-15 01:26:27 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.