Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Rattus norvegicus
Genetic Insert: Gephyrin
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFPC2; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:36314779
Comments: Gephyrin C3 cassette encodes NHPFYTSPAVFMANHGQPIPGLISYSHHATGSADKR after K243 (Thought to be expressed in astrocytes for MoCo biosynthesis and prevents olgomerization of gephyrin molecules for synapse scaffolding function in neurons)
Proper citation: RRID:Addgene_199610 Copy
Vector Backbone Description: Backbone Marker:John Dueber; Vector Backbone:pYTK090; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37930278
Proper citation: RRID:Addgene_198864 Copy
Species: Synthetic
Genetic Insert: Int.8 Spacer
Vector Backbone Description: Backbone Marker:John Dueber; Vector Backbone:pYTK090; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37930278
Proper citation: RRID:Addgene_198865 Copy
Species: Other
Genetic Insert: sfGFP-150TAA
Vector Backbone Description: Backbone Size:5205; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34590824
Comments: Production of full-length protein requires TAA suppression machinery.
Please visit https://doi.org/10.1101/2021.04.12.439361 for bioRxiv preprint.
Proper citation: RRID:Addgene_164581 Copy
Species: Zea mays; Agrobacterium tumefaciens
Genetic Insert: pPLTP::BBM cassette
Vector Backbone Description: Backbone Size:6500; Vector Backbone:pBUE411; Vector Types:Plant Expression, CRISPR, plant binary vector; Bacterial Resistance:Kanamycin
Comments: Please visit https://www.biorxiv.org/content/10.1101/2022.09.02.506370v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_198234 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: pTPI1
Vector Backbone Description: Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37058502
Comments: Cloning Method: Goldon Gate Assembly
Proper citation: RRID:Addgene_198648 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: pCYC1
Vector Backbone Description: Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37058502
Comments: Cloning Method: Goldon Gate Assembly
Proper citation: RRID:Addgene_198649 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: pPGK1
Vector Backbone Description: Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37058502
Comments: Cloning Method: Goldon Gate Assembly
Proper citation: RRID:Addgene_198646 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: pTPI1
Vector Backbone Description: Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37058502
Comments: Cloning Method: Goldon Gate Assembly
Proper citation: RRID:Addgene_198647 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: pENO2
Vector Backbone Description: Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37058502
Comments: Cloning Method: Goldon Gate Assembly
Proper citation: RRID:Addgene_198644 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: pTDH3
Vector Backbone Description: Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37058502
Comments: Cloning Method: Goldon Gate Assembly
Proper citation: RRID:Addgene_198642 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtNIA1 gRNAs fused to TLS1 tags
Vector Backbone Description: Vector Backbone:pMDC100; Vector Types:Plant Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:36593415
Comments: Please refer to the GO CRISP Cloning Protocol linked above for additional information.
Proper citation: RRID:Addgene_196980 Copy
Species: Other
Genetic Insert: GFP
Vector Backbone Description: Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37058502
Comments: Cloning Method: Goldon Gate Assembly
Proper citation: RRID:Addgene_198659 Copy
Species: Synthetic
Genetic Insert: Adaptor
Vector Backbone Description: Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37058502
Comments: Cloning Method: Goldon Gate Assembly
Proper citation: RRID:Addgene_198657 Copy
Species: Synthetic
Genetic Insert: Adaptor
Vector Backbone Description: Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37058502
Comments: Cloning Method: Goldon Gate Assembly
Proper citation: RRID:Addgene_198658 Copy
Species: Synthetic
Genetic Insert: scrambled gp78 G2BR sequence
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34879065
Comments: Encodes a scrambled gp78 G2BR sequence: SKANDSRELQFRKMRLRAQRQVQELDKL
Proper citation: RRID:Addgene_185345 Copy
Species: Synthetic
Genetic Insert: Adaptor
Vector Backbone Description: Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37058502
Comments: Cloning Method: Goldon Gate Assembly
Proper citation: RRID:Addgene_198655 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: tADH1
Vector Backbone Description: Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37058502
Comments: Cloning Method: Goldon Gate Assembly
Proper citation: RRID:Addgene_198653 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: tCYC1
Vector Backbone Description: Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37058502
Comments: Cloning Method: Goldon Gate Assembly
Proper citation: RRID:Addgene_198654 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: pPDA1
Vector Backbone Description: Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37058502
Comments: Cloning Method: Goldon Gate Assembly
Proper citation: RRID:Addgene_198651 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
