Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 370 showing 7381 ~ 7400 out of 33,912 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_198672

http://www.addgene.org/198672

Species: Saccharomyces cerevisiae
Genetic Insert: X4_DW
Vector Backbone Description: Backbone Marker:IndBioTech Lab; Vector Backbone:pGA-blue; Vector Types:Yeast Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37058502
Comments: Cloning Method: Goldon Gate Assembly

Proper citation: RRID:Addgene_198672 Copy   


http://www.addgene.org/87723

Species: Homo sapiens
Genetic Insert: SPAST
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:4300; Vector Backbone:pCMV-Tag; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:20430936
Comments: Cloning of spastin cDNA into pCMV-Tag EcoICRI and BamHI sites removed myc tag. To detect spastin, use an anti-spastin antibody.

Proper citation: RRID:Addgene_87723 Copy   


http://www.addgene.org/87721

Species: Homo sapiens
Genetic Insert: SPAST
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:4300; Vector Backbone:pCMV-Tag; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:20430936

Proper citation: RRID:Addgene_87721 Copy   


  • RRID:Addgene_87799

http://www.addgene.org/87799

Vector Backbone Description: Backbone Marker:EMD Millipore; Vector Backbone:pRSFduet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28349302
Comments: Additional reference: Zhang, Y.; Du, W.X.; Fregevu, C.; Kothary, M.H.; Harden, L; McHugh, T.H. Expression, purification, and characterization of almond (Prunus dulcis) allergen Pru du 4. J. Agric Food Chem 2014, 62, 12695-700. PMID: 25437489

Proper citation: RRID:Addgene_87799 Copy   


  • RRID:Addgene_87715

    This resource has 1+ mentions.

http://www.addgene.org/87715

Species: Homo sapiens
Genetic Insert: SPAST
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:4300; Vector Backbone:pCMV-Tag; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:20430936

Proper citation: RRID:Addgene_87715 Copy   


  • RRID:Addgene_87797

    This resource has 1+ mentions.

http://www.addgene.org/87797

Vector Backbone Description: Backbone Marker:EMD Millipore; Vector Backbone:pRSFduet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28349302
Comments: Additional reference: Zhang, Y.; Du, W.X.; Fregevu, C.; Kothary, M.H.; Harden, L; McHugh, T.H. Expression, purification, and characterization of almond (Prunus dulcis) allergen Pru du 4. J. Agric Food Chem 2014, 62, 12695-700. PMID: 25437489

Proper citation: RRID:Addgene_87797 Copy   


  • RRID:Addgene_87798

    This resource has 1+ mentions.

http://www.addgene.org/87798

Vector Backbone Description: Backbone Marker:EMD Millipore; Vector Backbone:pRSFduet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28349302
Comments: Additional reference: Zhang, Y.; Du, W.X.; Fregevu, C.; Kothary, M.H.; Harden, L; McHugh, T.H. Expression, purification, and characterization of almond (Prunus dulcis) allergen Pru du 4. J. Agric Food Chem 2014, 62, 12695-700. PMID: 25437489

Proper citation: RRID:Addgene_87798 Copy   


http://www.addgene.org/87730

Species: Homo sapiens
Genetic Insert: SPAST
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:4300; Vector Backbone:pCMV-Tag; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:20430936
Comments: Cloning of spastin cDNA into pCMV-Tag EcoICRI and ApaI sites removed myc tag. To detect spastin, use an anti-spastin antibody.

Proper citation: RRID:Addgene_87730 Copy   


http://www.addgene.org/87900

Species: Homo sapiens
Genetic Insert: DYSF, alt exon 1a, 17
Vector Backbone Description: Vector Backbone:pUC57 Kan; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: There are alternative isoforms of the dysferlin protein. The insert contained in this plasmid is described as such: 1. Dysferlin can utilize exon 1 or alternative exon 1a to build a full protein. Therefore, which exon 1 has been included in the construct is noted. 2. Exons 5a, 17 and 40a are optional exons, so if the exon is listed, it is included in the name. 3. The remainder of the exons are not optional, and are included in all constructs.

Proper citation: RRID:Addgene_87900 Copy   


http://www.addgene.org/87901

Species: Homo sapiens
Genetic Insert: DYSF, alt exon 1a, 40a
Vector Backbone Description: Vector Backbone:pUC57 Kan; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: There are alternative isoforms of the dysferlin protein. The insert contained in this plasmid is described as such: 1. Dysferlin can utilize exon 1 or alternative exon 1a to build a full protein. Therefore, which exon 1 has been included in the construct is noted. 2. Exons 5a, 17 and 40a are optional exons, so if the exon is listed, it is included in the name. 3. The remainder of the exons are not optional, and are included in all constructs.

Proper citation: RRID:Addgene_87901 Copy   


http://www.addgene.org/87908

Species: Synthetic
Genetic Insert: sgGFP1, sgCas9
Vector Backbone Description: Backbone Marker:Thermofisher; Backbone Size:2600; Vector Backbone:pENTR221; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28930690

Proper citation: RRID:Addgene_87908 Copy   


http://www.addgene.org/87889

Species: Homo sapiens
Genetic Insert: DYSF, alt exon 1, 5a, 40a
Vector Backbone Description: Vector Backbone:pUC57 Kan; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: There are alternative isoforms of the dysferlin protein. The insert contained in this plasmid is described as such: 1. Dysferlin can utilize exon 1 or alternative exon 1a to build a full protein. Therefore, which exon 1 has been included in the construct is noted. 2. Exons 5a, 17 and 40a are optional exons, so if the exon is listed, it is included in the name. 3. The remainder of the exons are not optional, and are included in all constructs.

Proper citation: RRID:Addgene_87889 Copy   


  • RRID:Addgene_87922

http://www.addgene.org/87922

Species: K. stuttgartiensis
Genetic Insert: Kuste2803
Vector Backbone Description: Vector Backbone:pET24; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26975050
Comments: protein sequence: MKKLVLINPHPMGNVGEENVSVLNQMPVNLGYLKVLTPGNWQVDIIDETQEYAIDENTGDITFGGADLVGITSVSYQADRAYKIATACRKRGIPVIMGGIHATSNPDEAAKYVDSVVIREGITLWSTIIDDFEKGRLRKRYDGGLTPMEIYCNLSPDRKFLKDKYKYRYSGIITTAGCPFACEFCSVPQFQGQKYRERPVDDILNEFESIKGQYRGLILTDENFYGHSKKSNERVRTLFKGMVERGIYQNWFGFTSLNIYKDDETLEYMAKSGCVGVLIGIESIEEESLKSMNKNVNLKISVENYYEAIANIRKHGLAVWGTMVFGNDADTSGTFERVADFILDSHIDIMTCGILCPFINTPLYHRLNRENRLFRTHFPEDWKYYTSHHLTYVLKKLTLDEMIEGFQYLYDRIFATEVLRKRFHRAKDELNNNMNAAMFAFRVNLDWQNVYQHLIQNLKDLHTSGDYEAALKCYVDTDKQGKGKKLASIEAAPLEHHHHHH-

Proper citation: RRID:Addgene_87922 Copy   


  • RRID:Addgene_87923

http://www.addgene.org/87923

Species: K. stuttgartiensis
Genetic Insert: Kuste3608
Vector Backbone Description: Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26975050
Comments: protein sequence: MGSSHHHHHHSSGLVPRGSHMKKMMLINPHKPGRHGEESITVIVQMPLNLAYIKALTPGDWEFDVIDENIELAIDDNGELTFAPVDLVCITSVTYQSPRAYKIATACKRKGMTVIMGGIHASVMPEEASKYVDTVFIGEAEEVWPRVIKDFEAGKLKKVYDGGLPPLNLMKRVFPDREFLRKKYNYKFSSIVTTKGCPNYCDFCSVPTFQGRKFRERPYEDVLEELAATDYKGLMLAEDNFYGHGKRSNERARNLFKGMVERNLQKDWLGFTALNISQDKETLDYMAKSGCFGMLMGIESTNETVLEKMNKQVNLKLGTESYYDCIQKIHDAGLVTWGSVVFGADGDGKDSFKRMTDFILENNIDILTFGINCPFPKTQLYKRLDSEKRIFRKNYPDDWEYYDTAHVVHRLVDMTLEDFIEGMQYVYDHIYAGDNLRKRFRNSIKTTNNPRNSMFAFRVGSDWQQVFDQVLENLRLLYDSGDYYKDYYKSNSVSVSKKPLVESITT-

Proper citation: RRID:Addgene_87923 Copy   


  • RRID:Addgene_87921

http://www.addgene.org/87921

Species: K. stuttgartiensis
Genetic Insert: Kuste2803
Vector Backbone Description: Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26975050
Comments: protein sequence: MGSSHHHHHHSSGLVPRGSHMKKLVLINPHPMGNVGEENVSVLNQMPVNLGYLKVLTPGNWQVDIIDETQEYAIDENTGDITFGGADLVGITSVSYQADRAYKIATACRKRGIPVIMGGIHATSNPDEAAKYVDSVVIREGITLWSTIIDDFEKGRLRKRYDGGLTPMEIYCNLSPDRKFLKDKYKYRYSGIITTAGCPFACEFCSVPQFQGQKYRERPVDDILNEFESIKGQYRGLILTDENFYGHSKKSNERVRTLFKGMVERGIYQNWFGFTSLNIYKDDETLEYMAKSGCVGVLIGIESIEEESLKSMNKNVNLKISVENYYEAIANIRKHGLAVWGTMVFGNDADTSGTFERVADFILDSHIDIMTCGILCPFINTPLYHRLNRENRLFRTHFPEDWKYYTSHHLTYVLKKLTLDEMIEGFQYLYDRIFATEVLRKRFHRAKDELNNNMNAAMFAFRVNLDWQNVYQHLIQNLKDLHTSGDYEAALKCYVDTDKQGKGKKLASIEAAP-

Proper citation: RRID:Addgene_87921 Copy   


  • RRID:Addgene_87924

http://www.addgene.org/87924

Species: K. stuttgartiensis
Genetic Insert: Kuste3608
Vector Backbone Description: Vector Backbone:pET28a-MBP; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26975050
Comments: protein sequence: MGSSHHHHHHSSGKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTSSGLVPRGSHMKKMMLINPHKPGRHGEESITVIVQMPLNLAYIKALTPGDWEFDVIDENIELAIDDNGELTFAPVDLVCITSVTYQSPRAYKIATACKRKGMTVIMGGIHASVMPEEASKYVDTVFIGEAEEVWPRVIKDFEAGKLKKVYDGGLPPLNLMKRVFPDREFLRKKYNYKFSSIVTTKGCPNYCDFCSVPTFQGRKFRERPYEDVLEELAATDYKGLMLAEDNFYGHGKRSNERARNLFKGMVERNLQKDWLGFTALNISQDKETLDYMAKSGCFGMLMGIESTNETVLEKMNKQVNLKLGTESYYDCIQKIHDAGLVTWGSVVFGADGDGKDSFKRMTDFILENNIDILTFGINCPFPKTQLYKRLDSEKRIFRKNYPDDWEYYDTAHVVHRLVDMTLEDFIEGMQYVYDHIYAGDNLRKRFRNSIKTTNNPRNSMFAFRVGSDWQQVFDQVLENLRLLYDSGDYYKDYYKSNSVSVSKKPLVESITT-

Proper citation: RRID:Addgene_87924 Copy   


http://www.addgene.org/87882

Species: Homo sapiens
Genetic Insert: MKK6
Vector Backbone Description: Vector Backbone:pET28 NKI LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28242696

Proper citation: RRID:Addgene_87882 Copy   


  • RRID:Addgene_87880

http://www.addgene.org/87880

Species: Homo sapiens
Genetic Insert: MKK4
Vector Backbone Description: Vector Backbone:pET28 NKI LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin

Proper citation: RRID:Addgene_87880 Copy   


  • RRID:Addgene_87878

http://www.addgene.org/87878

Species: Homo sapiens
Genetic Insert: MKK3
Vector Backbone Description: Vector Backbone:pET28 NKI LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin

Proper citation: RRID:Addgene_87878 Copy   


http://www.addgene.org/87898

Species: Homo sapiens
Genetic Insert: DYSF, alt exon 1a, 5a
Vector Backbone Description: Vector Backbone:pUC57 Kan; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: There are alternative isoforms of the dysferlin protein. The insert contained in this plasmid is described as such: 1. Dysferlin can utilize exon 1 or alternative exon 1a to build a full protein. Therefore, which exon 1 has been included in the construct is noted. 2. Exons 5a, 17 and 40a are optional exons, so if the exon is listed, it is included in the name. 3. The remainder of the exons are not optional, and are included in all constructs.

Proper citation: RRID:Addgene_87898 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X