Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Mus musculus
Genetic Insert: 5ht6
Vector Backbone Description: Backbone Marker:Contech; Backbone Size:4700; Vector Backbone:pEGFP-N3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:18256283
Proper citation: RRID:Addgene_35624 Copy
Species: Mus musculus
Genetic Insert: nAChR beta2 L349M 365AAQA368
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:5472; Vector Backbone:pCI-neo; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21187334
Proper citation: RRID:Addgene_35610 Copy
Species: Mus musculus
Genetic Insert: Tie2 promoter
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:2462; Vector Backbone:pSP72; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9096345
Comments: This vector contains Tie2 promoter, SV40 polyA signal and Tie2 minimum enhancer fragment. MCS (HindIII and NotI) are located between the promoter and pA signal where you can insert your cDNA as indicated. DNA fragments can be excised by SalI digest from injection.
Proper citation: RRID:Addgene_35962 Copy
Species: Mus musculus
Genetic Insert: Tie2 promoter
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:3000; Vector Backbone:pBluescript II SK (+); Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9096345
Comments: Positive control DNA where LacZ is expressed under the control of Tie2 promoter and enhander using the longer enhancer fragment as indicated in the map. Insert DNA fragments can be excised by SalI digest.
Proper citation: RRID:Addgene_35965 Copy
Species: Mus musculus
Genetic Insert: Zinc Finger Protein 423
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:6295; Vector Backbone:pMSCV puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20200519
Proper citation: RRID:Addgene_35971 Copy
Species: Mus musculus
Genetic Insert: fibronectin type III domain containing 5
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:3519; Vector Backbone:pCR-Blunt II-TOPO; Vector Types:cloning vector; Bacterial Resistance:Kanamycin
Defining Citation: PMID:22237023
Comments: The Fndc5 gene has a high GC content and therefore may be difficult to re-clone by PCR, restriction digest should be used in re-cloning attempts.
Proper citation: RRID:Addgene_35970 Copy
Species: Mus musculus
Genetic Insert: G protein subunit alpha q
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:19936219
Proper citation: RRID:Addgene_36073 Copy
Species: Mus musculus
Genetic Insert: G protein subunit Gamma 12
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:17581822
Proper citation: RRID:Addgene_36109 Copy
Species: Mus musculus
Genetic Insert: alpha-Fodrin cleavage site
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:peYFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:15663939
Proper citation: RRID:Addgene_36182 Copy
Species: Mus musculus
Genetic Insert: Dynamin 1
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:17463283
Proper citation: RRID:Addgene_36263 Copy
Species: Mus musculus
Genetic Insert: FGFR2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:10851026
Proper citation: RRID:Addgene_33248 Copy
Species: Mus musculus
Genetic Insert: Sirt3
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20235147
Proper citation: RRID:Addgene_33309 Copy
Species: Mus musculus
Genetic Insert: USF
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV566; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9891084
Comments: The A-USF aa sequence: MAYPYDVPDYAHMASMTGGQQMGRDPDEEEDDEEELEEDLENWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHGLEVVIKNDSN
This includes the N-terminal HA tag along with the acidic aa extension and the HLH-B-ZIP region of USF.
Proper citation: RRID:Addgene_33360 Copy
Species: Mus musculus
Genetic Insert: C/EBP
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9447994
Comments: Contains the amphipathic extension: LEQRAEE LARENEELEKEAEELEQENAE fused to the leucine zipper of C/EBP
Proper citation: RRID:Addgene_33352 Copy
Species: Mus musculus
Genetic Insert: Atoh1
Vector Backbone Description: Backbone Marker:Addgene plasmid #33336; Backbone Size:6575; Vector Backbone:pMSCV-IRES-GFP; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20516124
Comments: ER = estrogen-responsive element engineered to be induced by 4-hydroxytamoxifen (4-HT)
Proper citation: RRID:Addgene_33335 Copy
Species: Mus musculus
Genetic Insert: Calcium/Calmodulin dependent protein kinase kinase beta
Vector Backbone Description: Backbone Size:8000; Vector Backbone:pRRLsin.PPT.hPGK.FLAG-CaMKKbeta-IRES.GFP; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21669867
Comments: Addgene NGS results identified a D312A mutation in CaMKKbeta relative to NM_145358.1.
Proper citation: RRID:Addgene_33322 Copy
Species: Mus musculus
Genetic Insert: Bcl10
Vector Backbone Description: Vector Backbone:pEF-FLAG-Strep; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21896478
Proper citation: RRID:Addgene_33314 Copy
Species: Mus musculus
Genetic Insert: E47
Vector Backbone Description: Backbone Marker:Sigma; Backbone Size:4700; Vector Backbone:p3xFlag-CMV-7.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21610693
Proper citation: RRID:Addgene_34585 Copy
Species: Mus musculus
Genetic Insert: Arg1
Vector Backbone Description: Vector Backbone:pMIY; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_34581 Copy
Species: Mus musculus
Genetic Insert: BATF
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5597; Vector Backbone:pcDNA3.1 hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21566115
Proper citation: RRID:Addgene_34575 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
