Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 376 showing 7501 ~ 7520 out of 12,972 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_111035

http://www.addgene.org/111035

Species: Mus musculus
Genetic Insert: TLN2
Vector Backbone Description: Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29723415

Proper citation: RRID:Addgene_111035 Copy   


  • RRID:Addgene_111038

http://www.addgene.org/111038

Species: Mus musculus
Genetic Insert: TLN2
Vector Backbone Description: Backbone Size:5362; Vector Backbone:pET151TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29723415

Proper citation: RRID:Addgene_111038 Copy   


  • RRID:Addgene_111271

    This resource has 1+ mentions.

http://www.addgene.org/111271

Species: Mus musculus
Genetic Insert: murine Syk tandem SH2 domains (Ser 8 to Gln 264), with Y130E mutation to mimic phosphorylation
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREEVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ

Proper citation: RRID:Addgene_111271 Copy   


  • RRID:Addgene_111273

http://www.addgene.org/111273

Species: Mus musculus
Genetic Insert: murine Syk (N)SH2 domain plus interdomain A (Ser 8 to His 162), with an N-terminal (His)6 tag and TEV cleavage site
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MHHHHHHENLYFQGSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAH

Proper citation: RRID:Addgene_111273 Copy   


  • RRID:Addgene_111418

http://www.addgene.org/111418

Species: Mus musculus
Genetic Insert: murine Syk (C)SH2 domain plus interdomain A (Phe 119 to Gln 264), without any tag
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30051939
Comments: encoding the following protein sequence: MFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ

Proper citation: RRID:Addgene_111418 Copy   


  • RRID:Addgene_111419

http://www.addgene.org/111419

Species: Mus musculus
Genetic Insert: murine Syk (C)SH2 domain (His 162 to Gln 264), without any tag
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30051939
Comments: encoding the following protein sequence: MHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ

Proper citation: RRID:Addgene_111419 Copy   


http://www.addgene.org/111390

Species: Mus musculus
Genetic Insert: mCAR
Vector Backbone Description: Backbone Size:4115; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29879392

Proper citation: RRID:Addgene_111390 Copy   


http://www.addgene.org/111395

Species: Mus musculus
Genetic Insert: mCAR
Vector Backbone Description: Backbone Size:4825; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29879392

Proper citation: RRID:Addgene_111395 Copy   


  • RRID:Addgene_111510

    This resource has 10+ mentions.

http://www.addgene.org/111510

Species: Mus musculus
Genetic Insert: ERK KTR
Vector Backbone Description: Vector Backbone:pHR; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29859829

Proper citation: RRID:Addgene_111510 Copy   


  • RRID:Addgene_11158

    This resource has 1+ mentions.

http://www.addgene.org/11158

Species: Mus musculus
Genetic Insert: Cralbp promoter
Vector Backbone Description: Backbone Size:3086; Vector Backbone:pCAGEN; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:14603031
Comments: The Cralbp promoter is specific for Muller glial cells in the retina

Proper citation: RRID:Addgene_11158 Copy   


  • RRID:Addgene_111560

    This resource has 1+ mentions.

http://www.addgene.org/111560

Species: Mus musculus
Genetic Insert: Gasdermin D
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Backbone Size:5600; Vector Backbone:pET SUMO; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29539421

Proper citation: RRID:Addgene_111560 Copy   


http://www.addgene.org/111566

Species: Mus musculus
Genetic Insert: Murine light chain
Vector Backbone Description: Backbone Marker:ATUM (formerly DNA 2.0); Backbone Size:2673; Vector Backbone:pJ201; Vector Types:Synthetic Biology, Cloning Vector; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29086492

Proper citation: RRID:Addgene_111566 Copy   


http://www.addgene.org/111657

Species: Mus musculus
Genetic Insert: BICDR1-GFP
Vector Backbone Description: Backbone Size:4530; Vector Backbone:pOmnibac; Vector Types:Insect Expression; Bacterial Resistance:Gentamicin
Defining Citation: PMID:29420470
Comments: Please note that there are some discrepancies between Addgene's quality control sequence and the depositor's sequence. The depositor noted that these discrepancies do NOT affect plasmid function.

Proper citation: RRID:Addgene_111657 Copy   


  • RRID:Addgene_111627

http://www.addgene.org/111627

Species: Mus musculus
Genetic Insert: BAK
Vector Backbone Description: Backbone Marker:Mark Van Delft; Backbone Size:7005; Vector Backbone:pMIH/MSCV-IRES-hygro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29472455

Proper citation: RRID:Addgene_111627 Copy   


  • RRID:Addgene_111601

http://www.addgene.org/111601

Species: Mus musculus
Genetic Insert: mouse LRRC33
Vector Backbone Description: Backbone Size:4500; Vector Backbone:plexm; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29909984

Proper citation: RRID:Addgene_111601 Copy   


  • RRID:Addgene_111771

    This resource has 1+ mentions.

http://www.addgene.org/111771

Species: Mus musculus
Genetic Insert: Mef2c-tPT2A-GFP
Vector Backbone Description: Backbone Size:3000; Vector Backbone:pGEMT-easy; Vector Types:Cloning intermediate; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28526819
Comments: Please note that several discrepancies were found between Addgene's quality control and the depositor's sequence. The depositor noted that these discrepancies do NOT affect plasmid function. If co-express two genes connected by solely P2A or T2A is desired rather than the tandom P2A-T2A here, just use available restriction enzymes on the vector. Please refer to the uploaded plasmid sequence and the published article for details.

Proper citation: RRID:Addgene_111771 Copy   


  • RRID:Addgene_111811

    This resource has 10+ mentions.

http://www.addgene.org/111811

Species: Mus musculus
Genetic Insert: Ribosomal protein L22
Vector Backbone Description: Backbone Size:4466; Vector Backbone:pZac2.1; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30174118

Proper citation: RRID:Addgene_111811 Copy   


http://www.addgene.org/111799

Species: Mus musculus
Genetic Insert: mSesn2
Vector Backbone Description: Vector Backbone:pcDNA; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25040165

Proper citation: RRID:Addgene_111799 Copy   


http://www.addgene.org/111818

Species: Mus musculus
Genetic Insert: Mef2c
Vector Backbone Description: Backbone Size:3000; Vector Backbone:pGEMT-easy; Vector Types:cloning intermediate; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28526819
Comments: Please note that there are some discrepancies between Addgene's quality control sequence and the depositor's sequence. The depositor noted that these discrepancies do NOT affect plasmid function.

Proper citation: RRID:Addgene_111818 Copy   


  • RRID:Addgene_111859

    This resource has 1+ mentions.

http://www.addgene.org/111859

Species: Mus musculus
Genetic Insert: BICDR1
Vector Backbone Description: Backbone Size:4517; Vector Backbone:pOmnibac; Vector Types:Insect Expression; Bacterial Resistance:Gentamicin
Defining Citation: PMID:29420470
Comments: Please note that there are some discrepancies between Addgene's quality control sequence and the depositor's sequence. The depositor noted that these discrepancies do NOT affect plasmid function.

Proper citation: RRID:Addgene_111859 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X