Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 378 showing 7541 ~ 7560 out of 69,655 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection

http://www.addgene.org/16277

Species: Homo sapiens
Genetic Insert: hTRF1
Vector Backbone Description: Backbone Size:5900; Vector Backbone:pWZL Hygro NFLAG; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12169636

Proper citation: RRID:Addgene_16277 Copy   


http://www.addgene.org/162811

Species: Homo sapiens
Genetic Insert: BsmBI_(C1A)-Intein_DD
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524

Proper citation: RRID:Addgene_162811 Copy   


http://www.addgene.org/162814

Species: Homo sapiens
Genetic Insert: SMIM38(C-TAG)-Intein-DD
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: MTSWPGGSFGPDPLLALLVVILLARLILWSCLGTYIDYRLAQRRPQKPKQD(TAG) - UniProtKB - A0A286YFK9 (SIM38_HUMAN)

Proper citation: RRID:Addgene_162814 Copy   


http://www.addgene.org/162804

Species: Homo sapiens
Genetic Insert: Ub-BsmBI_IRES_Blasticidin
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524

Proper citation: RRID:Addgene_162804 Copy   


http://www.addgene.org/16281

Species: Homo sapiens
Genetic Insert: hTRF1
Vector Backbone Description: Backbone Size:5900; Vector Backbone:pWZL Hygro NFLAG; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12169636

Proper citation: RRID:Addgene_16281 Copy   


http://www.addgene.org/162970

Species: Homo sapiens
Genetic Insert: human Glucose response protein 78 promoter
Vector Backbone Description: Vector Backbone:pDonr231; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162970 Copy   


http://www.addgene.org/162976

Species: Homo sapiens
Genetic Insert: human pGK promoter
Vector Backbone Description: Vector Backbone:pDonr215; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162976 Copy   


  • RRID:Addgene_162975

    This resource has 1+ mentions.

http://www.addgene.org/162975

Species: Homo sapiens
Genetic Insert: human EF1alpha promoter
Vector Backbone Description: Vector Backbone:pDonr215; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162975 Copy   


http://www.addgene.org/162985

Species: Homo sapiens
Genetic Insert: methyltransferase like 3
Vector Backbone Description: Backbone Size:8762; Vector Backbone:Tet-pLKO-puro; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34088870

Proper citation: RRID:Addgene_162985 Copy   


  • RRID:Addgene_162984

    This resource has 1+ mentions.

http://www.addgene.org/162984

Species: Homo sapiens
Genetic Insert: methyltransferase like 3
Vector Backbone Description: Backbone Size:8762; Vector Backbone:Tet-pLKO-puro; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34088870

Proper citation: RRID:Addgene_162984 Copy   


http://www.addgene.org/162921

Species: Homo sapiens
Genetic Insert: human pGK promoter
Vector Backbone Description: Vector Backbone:pDonr233; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162921 Copy   


http://www.addgene.org/162923

Species: Homo sapiens
Genetic Insert: SV40 immediate early promoter
Vector Backbone Description: Vector Backbone:pDonr233; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162923 Copy   


  • RRID:Addgene_162925

    This resource has 1+ mentions.

http://www.addgene.org/162925

Species: Homo sapiens
Genetic Insert: human Ubiquitin C promoter
Vector Backbone Description: Vector Backbone:pDonr233; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162925 Copy   


http://www.addgene.org/163176

Species: Homo sapiens
Genetic Insert: WWTR1
Vector Backbone Description: Vector Backbone:pKLV2-U6gRNA5(BbsI)-PGKpuro2AmCherry-W; Vector Types:Mammalian Expression, Lentiviral, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32990596

Proper citation: RRID:Addgene_163176 Copy   


http://www.addgene.org/163179

Species: Homo sapiens
Genetic Insert: YAP1
Vector Backbone Description: Vector Backbone:pKLV2-U6gRNA5(BbsI)-PGKpuro2AmCherry-W; Vector Types:Mammalian Expression, Lentiviral, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32990596

Proper citation: RRID:Addgene_163179 Copy   


  • RRID:Addgene_16316

    This resource has 10+ mentions.

http://www.addgene.org/16316

Species: Homo sapiens
Genetic Insert: tau
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5370; Vector Backbone:pET29b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:9169052
Comments: For bacterial expression of human tau T40.

Proper citation: RRID:Addgene_16316 Copy   


http://www.addgene.org/163372

Species: Homo sapiens
Genetic Insert: Hypoxia Inducible Factor 2 alpha
Vector Backbone Description: Backbone Marker:Leonard Daly; Backbone Size:6163; Vector Backbone:HA-Clover-HIF-2_ Wildtype; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: Site-directed Mutagenesis

Proper citation: RRID:Addgene_163372 Copy   


http://www.addgene.org/163374

Species: Homo sapiens
Genetic Insert: Hypoxia Inducible Factor 2 alpha
Vector Backbone Description: Backbone Marker:Leonard Daly; Backbone Size:6163; Vector Backbone:HA-Clover-HIF-2_ Wildtype; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: Site-directed Mutagenesis

Proper citation: RRID:Addgene_163374 Copy   


http://www.addgene.org/163377

Species: Homo sapiens
Genetic Insert: Hypoxia Inducible Factor 2 alpha
Vector Backbone Description: Backbone Marker:Leonard Daly; Backbone Size:6163; Vector Backbone:HA-Clover-HIF-2_ Wildtype; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: Site-directed Mutagenesis

Proper citation: RRID:Addgene_163377 Copy   


http://www.addgene.org/163376

Species: Homo sapiens
Genetic Insert: Hypoxia Inducible Factor 2 alpha
Vector Backbone Description: Backbone Marker:Leonard Daly; Backbone Size:6163; Vector Backbone:HA-Clover-HIF-2_ Wildtype; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: Site-directed Mutagenesis

Proper citation: RRID:Addgene_163376 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X