Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Synthetic
Genetic Insert: BC45
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84439 Copy
Species: Synthetic
Genetic Insert: BC36
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84430 Copy
Species: Synthetic
Genetic Insert: BC31
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84425 Copy
Species: Synthetic
Genetic Insert: BC30
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84424 Copy
Species: Synthetic
Genetic Insert: BC33
Vector Backbone Description: Backbone Marker:Thermo Fisher Scientific; Vector Backbone:pCRII-TOPO; Vector Types:Barcoding plasmids; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37494033
Comments: This plasmid is part of the FREQ-Seq-Squared kit. See Addgene's kit collection page for more details: https://www.addgene.org/kits/
Proper citation: RRID:Addgene_84427 Copy
Species: Synthetic
Genetic Insert: mCherry
Vector Backbone Description: Backbone Marker:K. Kawakami lab; Vector Backbone:pT2KXIG; Vector Types:Zebrafish transgenesis; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25068273
Comments: The amino acid sequence of the Odc1-derived destabilizing element is: SHGFPPAVAAQDDGTLPMSCAQESGMDRHPAACASARINV.
Proper citation: RRID:Addgene_84603 Copy
Species: Synthetic
Genetic Insert: mCherry
Vector Backbone Description: Backbone Marker:K. Kawakami lab; Vector Backbone:pT2KXIG; Vector Types:Zebrafish transgenesis; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25068273
Proper citation: RRID:Addgene_84604 Copy
Species: Synthetic
Genetic Insert: Transport inhibitor response 1 (E3 ligase domain), IRES, single chain variable fragment-superfolder GFP
Vector Backbone Description: Vector Backbone:pUbC lentivirus expression vector (2nd generation); Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27313041
Proper citation: RRID:Addgene_84563 Copy
Species: Synthetic
Genetic Insert: FLIP - Puro
Vector Backbone Description: Backbone Marker:TAKARA; Vector Backbone:pUC118; Vector Types:Mouse Targeting, Cre/Lox; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28135257
Proper citation: RRID:Addgene_84538 Copy
Species: Synthetic
Genetic Insert: U2T4U2-EYFP
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3722; Vector Backbone:pBI; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28771312
Proper citation: RRID:Addgene_84551 Copy
Species: Synthetic
Genetic Insert: T2U4T2-EYFP
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3722; Vector Backbone:pBI; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28771312
Proper citation: RRID:Addgene_84553 Copy
Species: Synthetic
Genetic Insert: T2U2T2U2-EYFP
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3722; Vector Backbone:pBI; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28771312
Proper citation: RRID:Addgene_84552 Copy
Species: Synthetic
Genetic Insert: U2T2-EYFP
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3722; Vector Backbone:pBI; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28771312
Proper citation: RRID:Addgene_84543 Copy
Species: Synthetic
Genetic Insert: U2T4-EYFP
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3722; Vector Backbone:pBI; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28771312
Proper citation: RRID:Addgene_84548 Copy
Species: Synthetic
Genetic Insert: T2U2T2-EYFP
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3722; Vector Backbone:pBI; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28771312
Proper citation: RRID:Addgene_84549 Copy
Species: Synthetic
Genetic Insert: JNKsubDD-YPet-NES
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5500; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26548610
Proper citation: RRID:Addgene_84633 Copy
Species: Synthetic
Genetic Insert: AMPKsub-YPet-NES
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5500; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26548610
Proper citation: RRID:Addgene_84635 Copy
Species: Synthetic
Genetic Insert: AMPKsub-YPet-Kras
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5500; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26548610
Proper citation: RRID:Addgene_84638 Copy
Species: Synthetic
Genetic Insert: huAsCpf1
Vector Backbone Description: Backbone Size:4963; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27918548
Comments: Contains a BsmBI cloning cassette for U6 driven crRNA expression.
Proper citation: RRID:Addgene_84741 Copy
Species: Synthetic
Genetic Insert: PA50
Vector Backbone Description: Backbone Marker:Susan Lindquist (Addgene plasmid # 14147); Backbone Size:5647; Vector Backbone:pAG416-Gal-ccdB; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26308983
Proper citation: RRID:Addgene_84902 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.