Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 407 showing 8121 ~ 8140 out of 33,912 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_156479

http://www.addgene.org/156479

Species: Synthetic
Genetic Insert: Nsp10
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNGFAVx

Proper citation: RRID:Addgene_156479 Copy   


  • RRID:Addgene_156476

http://www.addgene.org/156476

Species: Synthetic
Genetic Insert: Nsp7
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQx

Proper citation: RRID:Addgene_156476 Copy   


  • RRID:Addgene_156478

http://www.addgene.org/156478

Species: Synthetic
Genetic Insert: Nsp9
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQx

Proper citation: RRID:Addgene_156478 Copy   


  • RRID:Addgene_156477

http://www.addgene.org/156477

Species: Synthetic
Genetic Insert: Nsp8
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQx

Proper citation: RRID:Addgene_156477 Copy   


  • RRID:Addgene_156471

http://www.addgene.org/156471

Species: Synthetic
Genetic Insert: Nsp3c_SUD-C
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: MDSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLR

Proper citation: RRID:Addgene_156471 Copy   


  • RRID:Addgene_156473

http://www.addgene.org/156473

Species: Synthetic
Genetic Insert: Nsp3e_NAB
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETx

Proper citation: RRID:Addgene_156473 Copy   


  • RRID:Addgene_156481

    This resource has 1+ mentions.

http://www.addgene.org/156481

Species: Synthetic
Genetic Insert: Nsp15
Vector Backbone Description: Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37704626
Comments: insert amino acid sequence: GLQSLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLx

Proper citation: RRID:Addgene_156481 Copy   


  • RRID:Addgene_157657

http://www.addgene.org/157657

Species: Homo sapiens
Genetic Insert: Fibroblast growth factor 2
Vector Backbone Description: Backbone Size:5369; Vector Backbone:pHis; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32383752

Proper citation: RRID:Addgene_157657 Copy   


  • RRID:Addgene_157655

http://www.addgene.org/157655

Species: Homo sapiens
Genetic Insert: Apoptosis inhibitor 5
Vector Backbone Description: Backbone Size:5369; Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32383752

Proper citation: RRID:Addgene_157655 Copy   


http://www.addgene.org/157672

Species: Other
Genetic Insert: Cohesin (R.f) with ddFLN4, ELP, Histag and ybbR tag
Vector Backbone Description: Backbone Size:5200; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33191756

Proper citation: RRID:Addgene_157672 Copy   


  • RRID:Addgene_157639

http://www.addgene.org/157639

Species: Batis maritima
Genetic Insert: MHT
Vector Backbone Description: Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33104325

Proper citation: RRID:Addgene_157639 Copy   


  • RRID:Addgene_157642

http://www.addgene.org/157642

Genetic Insert: sMHT(1-113) -CheA
Vector Backbone Description: Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33104325

Proper citation: RRID:Addgene_157642 Copy   


  • RRID:Addgene_157641

http://www.addgene.org/157641

Genetic Insert: sMHT(1-113)
Vector Backbone Description: Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33104325

Proper citation: RRID:Addgene_157641 Copy   


  • RRID:Addgene_157640

http://www.addgene.org/157640

Genetic Insert: sMHT(1-113)-SYNZIP17
Vector Backbone Description: Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33104325

Proper citation: RRID:Addgene_157640 Copy   


  • RRID:Addgene_157777

http://www.addgene.org/157777

Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3939; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:31317736

Proper citation: RRID:Addgene_157777 Copy   


  • RRID:Addgene_15776

    This resource has 1+ mentions.

http://www.addgene.org/15776

Species: Homo sapiens
Genetic Insert: Sec16L
Vector Backbone Description: Backbone Marker:Glick Lab; Backbone Size:4731; Vector Backbone:pmGFP-c1 ( modified from pEGFP-c1); Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:17192411
Comments: Please note that we have identified a K466R missense mutation in the Sec16L/Sec16A region of this plasmid, and the start codon may not have been correctly identified when constructing this plasmid which may have resulted in the gene being truncated. However, we do not think that this should impact plasmid functionality.

Proper citation: RRID:Addgene_15776 Copy   


  • RRID:Addgene_15775

    This resource has 1+ mentions.

http://www.addgene.org/15775

Species: Homo sapiens
Genetic Insert: Sec16S
Vector Backbone Description: Backbone Marker:Glick Lab; Backbone Size:4731; Vector Backbone:pmGFPc1( modified from pEGFP-c1); Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:17192411

Proper citation: RRID:Addgene_15775 Copy   


  • RRID:Addgene_157741

http://www.addgene.org/157741

Vector Backbone Description: Backbone Size:5401; Vector Backbone:pelB-MBP (DNASU access. no. EvNO00813783); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: - Empty vector (kanamycin-R) adds TEV-protease-removable N-terminal PelB signal sequence + His10, plus potential C-term His6. Non-leaky expression due to T7lac promoter. - Has an advantage in leaving no added amino acid residues following TEV protease cleavage of PelB signal sequence + His10. This advantage is made possible by cloning into the two BseRI restriction sites. - Subcloning requires ligation-independent cloning and use of the two BseRI restriction sites that are present in this empty vector. The two BseRI sites span a removable 432 nucleotide sequence. Cloning into the BseRI-digested vector can be achieved using a ligation-independent system that is dependent on homologous recombination, such as the Takara In-Fusion HD Cloning Plus system, which requires simply designing the PCR-derived insert (containing the protein of interest) to contain 15 bp at each end that matches the 15 bp at each end of the linearized parent vector. In other words, add these 15 bp, AACCTGTACTTCCAA, to the 5' end of the PCR FORWARD primer, and add these 15 bp, GTGGTGGTGCTCGAG, to the 5' end of the PCR REVERSE primer. - The sequence of the added N-terminus is the PelB signal sequence (M1-A22 of GenBank #AAA24848) + 13 aa linker + His10-tag + 4 aa linker + TEV protease cleavage site. The N-terminal protein sequence is: MKYLLPTAAAGLLLLAAQPAMA + MDIGINSDPNSSS + HHHHHHHHHH + PMGS + ENLYFQ*X, where * is the TEV protease cleavage site and X is the N-terminal residue of the introduced protein of interest. Note that TEV protease cleaves most efficiently when X = S, G, A, M; for other compatible residues see Kapust et al 2002, PMID 12074568. - A C-terminal His6-tag is possible: if no stop codon is included in the cloned insert, the sequence LEHHHHHH is added to the C-terminus. - The PelB signal sequence directs the protein of interest to the E. coli inner membrane. Whether the protein traverses the inner membrane is dependent on the protein of interest. - BseRI cuts 8-10 nucleotides outside of its own recognition sequence and is a non-palindromic site. The placement & orientation of the two BseRI sites eliminates all of the BseRI recognition sequence in the resulting subclone. - To verify the PCR-generated insert sequence, use sequencing primers T7 (TAATACGACTCACTATAGGG), T7-Ter (GCTAGTTATTGCTCAGCGG).

Proper citation: RRID:Addgene_157741 Copy   


  • RRID:Addgene_157755

http://www.addgene.org/157755

Species: Homo sapiens
Genetic Insert: AURKA
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4733; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30070631

Proper citation: RRID:Addgene_157755 Copy   


  • RRID:Addgene_157762

http://www.addgene.org/157762

Species: Homo sapiens
Genetic Insert: TOMM22
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4722; Vector Backbone:pmCherry-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30070631

Proper citation: RRID:Addgene_157762 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X