Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pETM33_Nsp10 Resource Report Resource Website |
RRID:Addgene_156479 | Nsp10 | Synthetic | Kanamycin | PMID:37704626 | insert amino acid sequence: GAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNGFAVx | Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Gene insert is codon optimized for Ecoli. | 2026-08-29 12:57:57 | 0 |
|
pETM33_Nsp7 Resource Report Resource Website |
RRID:Addgene_156476 | Nsp7 | Synthetic | Kanamycin | PMID:37704626 | insert amino acid sequence: GQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQx | Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Gene insert is codon optimized for Ecoli. | 2026-08-29 12:57:57 | 0 |
|
pETM33_Nsp9 Resource Report Resource Website |
RRID:Addgene_156478 | Nsp9 | Synthetic | Kanamycin | PMID:37704626 | insert amino acid sequence: GNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQx | Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Gene insert is codon optimized for Ecoli. | 2026-08-29 12:57:57 | 0 |
|
pETM33_Nsp8 Resource Report Resource Website |
RRID:Addgene_156477 | Nsp8 | Synthetic | Kanamycin | PMID:37704626 | insert amino acid sequence: GAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQx | Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Gene insert is codon optimized for Ecoli. | 2026-08-29 12:57:57 | 0 |
|
pETM33_Nsp3c_SUD-C Resource Report Resource Website |
RRID:Addgene_156471 | Nsp3c_SUD-C | Synthetic | Kanamycin | PMID:37704626 | insert amino acid sequence: MDSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLR | Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Gene insert is codon optimized for Ecoli. | 2026-08-29 12:57:56 | 0 |
|
pETM33_Nsp3e_NAB Resource Report Resource Website |
RRID:Addgene_156473 | Nsp3e_NAB | Synthetic | Kanamycin | PMID:37704626 | insert amino acid sequence: GKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETx | Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Gene insert is codon optimized for Ecoli. | 2026-08-29 12:57:56 | 0 |
|
pETM33_Nsp15 Resource Report Resource Website 1+ mentions |
RRID:Addgene_156481 | Nsp15 | Synthetic | Kanamycin | PMID:37704626 | insert amino acid sequence: GLQSLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLx | Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Gene insert is codon optimized for Ecoli. | 2026-08-29 12:57:57 | 1 |
|
pHis-LMW_FGF2 Resource Report Resource Website |
RRID:Addgene_157657 | Fibroblast growth factor 2 | Homo sapiens | Kanamycin | PMID:32383752 | Backbone Size:5369; Vector Backbone:pHis; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | changed Cystein 211,229 to serine, deleted amino acids 1-134 | 2026-08-29 12:57:59 | 0 | |
|
pET28b-API5 Resource Report Resource Website |
RRID:Addgene_157655 | Apoptosis inhibitor 5 | Homo sapiens | Kanamycin | PMID:32383752 | Backbone Size:5369; Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-29 12:57:58 | 0 | ||
|
pET28a-Coh-ddFLN4-ELP(MV7E2)3-His-ybbR Resource Report Resource Website |
RRID:Addgene_157672 | Cohesin (R.f) with ddFLN4, ELP, Histag and ybbR tag | Other | Kanamycin | PMID:33191756 | Backbone Size:5200; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-29 12:57:59 | 0 | ||
|
pDH001 Resource Report Resource Website |
RRID:Addgene_157639 | MHT | Batis maritima | Kanamycin | PMID:33104325 | Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-29 12:57:58 | 0 | ||
|
pDH007 Resource Report Resource Website |
RRID:Addgene_157642 | sMHT(1-113) -CheA | Kanamycin | PMID:33104325 | Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-29 12:57:58 | 0 | |||
|
pDH006 Resource Report Resource Website |
RRID:Addgene_157641 | sMHT(1-113) | Kanamycin | PMID:33104325 | Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-29 12:57:58 | 0 | |||
|
pDH003 Resource Report Resource Website |
RRID:Addgene_157640 | sMHT(1-113)-SYNZIP17 | Kanamycin | PMID:33104325 | Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-29 12:57:58 | 0 | |||
|
pCMV Aquamarine Resource Report Resource Website |
RRID:Addgene_157777 | Kanamycin | PMID:31317736 | Backbone Marker:Clontech; Backbone Size:3939; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-29 12:58:00 | 0 | ||||
|
pmGFP-Sec16L Resource Report Resource Website 1+ mentions |
RRID:Addgene_15776 | Sec16L | Homo sapiens | Kanamycin | PMID:17192411 | Please note that we have identified a K466R missense mutation in the Sec16L/Sec16A region of this plasmid, and the start codon may not have been correctly identified when constructing this plasmid which may have resulted in the gene being truncated. However, we do not think that this should impact plasmid functionality. | Backbone Marker:Glick Lab; Backbone Size:4731; Vector Backbone:pmGFP-c1 ( modified from pEGFP-c1); Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | K466R | 2026-08-29 12:58:00 | 4 |
|
pmGFP-Sec16S Resource Report Resource Website 1+ mentions |
RRID:Addgene_15775 | Sec16S | Homo sapiens | Kanamycin | PMID:17192411 | Backbone Marker:Glick Lab; Backbone Size:4731; Vector Backbone:pmGFPc1( modified from pEGFP-c1); Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | N/A | 2026-08-29 12:58:00 | 3 | |
|
pelBHisTEV Resource Report Resource Website |
RRID:Addgene_157741 | Kanamycin | - Empty vector (kanamycin-R) adds TEV-protease-removable N-terminal PelB signal sequence + His10, plus potential C-term His6. Non-leaky expression due to T7lac promoter. - Has an advantage in leaving no added amino acid residues following TEV protease cleavage of PelB signal sequence + His10. This advantage is made possible by cloning into the two BseRI restriction sites. - Subcloning requires ligation-independent cloning and use of the two BseRI restriction sites that are present in this empty vector. The two BseRI sites span a removable 432 nucleotide sequence. Cloning into the BseRI-digested vector can be achieved using a ligation-independent system that is dependent on homologous recombination, such as the Takara In-Fusion HD Cloning Plus system, which requires simply designing the PCR-derived insert (containing the protein of interest) to contain 15 bp at each end that matches the 15 bp at each end of the linearized parent vector. In other words, add these 15 bp, AACCTGTACTTCCAA, to the 5' end of the PCR FORWARD primer, and add these 15 bp, GTGGTGGTGCTCGAG, to the 5' end of the PCR REVERSE primer. - The sequence of the added N-terminus is the PelB signal sequence (M1-A22 of GenBank #AAA24848) + 13 aa linker + His10-tag + 4 aa linker + TEV protease cleavage site. The N-terminal protein sequence is: MKYLLPTAAAGLLLLAAQPAMA + MDIGINSDPNSSS + HHHHHHHHHH + PMGS + ENLYFQ*X, where * is the TEV protease cleavage site and X is the N-terminal residue of the introduced protein of interest. Note that TEV protease cleaves most efficiently when X = S, G, A, M; for other compatible residues see Kapust et al 2002, PMID 12074568. - A C-terminal His6-tag is possible: if no stop codon is included in the cloned insert, the sequence LEHHHHHH is added to the C-terminus. - The PelB signal sequence directs the protein of interest to the E. coli inner membrane. Whether the protein traverses the inner membrane is dependent on the protein of interest. - BseRI cuts 8-10 nucleotides outside of its own recognition sequence and is a non-palindromic site. The placement & orientation of the two BseRI sites eliminates all of the BseRI recognition sequence in the resulting subclone. - To verify the PCR-generated insert sequence, use sequencing primers T7 (TAATACGACTCACTATAGGG), T7-Ter (GCTAGTTATTGCTCAGCGG). | Backbone Size:5401; Vector Backbone:pelB-MBP (DNASU access. no. EvNO00813783); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-29 12:58:00 | 0 | ||||
|
pEGFP N1 AURKA 1-110 Resource Report Resource Website |
RRID:Addgene_157755 | AURKA | Homo sapiens | Kanamycin | PMID:30070631 | Backbone Marker:Clontech; Backbone Size:4733; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | The first 110 amino acids of AURKA were cloned | 2026-08-29 12:58:00 | 0 | |
|
pmCherry N1 TOMM22 Resource Report Resource Website |
RRID:Addgene_157762 | TOMM22 | Homo sapiens | Kanamycin | PMID:30070631 | Backbone Marker:Clontech; Backbone Size:4722; Vector Backbone:pmCherry-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-29 12:58:00 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.