Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Bacterial Resistance:kanamycin (facet)


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

33,912 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
pETM33_Nsp10
 
Resource Report
Resource Website
RRID:Addgene_156479 Nsp10 Synthetic Kanamycin PMID:37704626 insert amino acid sequence: GAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNGFAVx Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin Gene insert is codon optimized for Ecoli. 2026-08-29 12:57:57 0
pETM33_Nsp7
 
Resource Report
Resource Website
RRID:Addgene_156476 Nsp7 Synthetic Kanamycin PMID:37704626 insert amino acid sequence: GQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQx Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin Gene insert is codon optimized for Ecoli. 2026-08-29 12:57:57 0
pETM33_Nsp9
 
Resource Report
Resource Website
RRID:Addgene_156478 Nsp9 Synthetic Kanamycin PMID:37704626 insert amino acid sequence: GNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQx Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin Gene insert is codon optimized for Ecoli. 2026-08-29 12:57:57 0
pETM33_Nsp8
 
Resource Report
Resource Website
RRID:Addgene_156477 Nsp8 Synthetic Kanamycin PMID:37704626 insert amino acid sequence: GAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQx Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin Gene insert is codon optimized for Ecoli. 2026-08-29 12:57:57 0
pETM33_Nsp3c_SUD-C
 
Resource Report
Resource Website
RRID:Addgene_156471 Nsp3c_SUD-C Synthetic Kanamycin PMID:37704626 insert amino acid sequence: MDSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLR Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin Gene insert is codon optimized for Ecoli. 2026-08-29 12:57:56 0
pETM33_Nsp3e_NAB
 
Resource Report
Resource Website
RRID:Addgene_156473 Nsp3e_NAB Synthetic Kanamycin PMID:37704626 insert amino acid sequence: GKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETx Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin Gene insert is codon optimized for Ecoli. 2026-08-29 12:57:56 0
pETM33_Nsp15
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_156481 Nsp15 Synthetic Kanamycin PMID:37704626 insert amino acid sequence: GLQSLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLx Backbone Size:6017; Vector Backbone:pETM33; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin Gene insert is codon optimized for Ecoli. 2026-08-29 12:57:57 1
pHis-LMW_FGF2
 
Resource Report
Resource Website
RRID:Addgene_157657 Fibroblast growth factor 2 Homo sapiens Kanamycin PMID:32383752 Backbone Size:5369; Vector Backbone:pHis; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin changed Cystein 211,229 to serine, deleted amino acids 1-134 2026-08-29 12:57:59 0
pET28b-API5
 
Resource Report
Resource Website
RRID:Addgene_157655 Apoptosis inhibitor 5 Homo sapiens Kanamycin PMID:32383752 Backbone Size:5369; Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-29 12:57:58 0
pET28a-Coh-ddFLN4-ELP(MV7E2)3-His-ybbR
 
Resource Report
Resource Website
RRID:Addgene_157672 Cohesin (R.f) with ddFLN4, ELP, Histag and ybbR tag Other Kanamycin PMID:33191756 Backbone Size:5200; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-29 12:57:59 0
pDH001
 
Resource Report
Resource Website
RRID:Addgene_157639 MHT Batis maritima Kanamycin PMID:33104325 Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-29 12:57:58 0
pDH007
 
Resource Report
Resource Website
RRID:Addgene_157642 sMHT(1-113) -CheA Kanamycin PMID:33104325 Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-29 12:57:58 0
pDH006
 
Resource Report
Resource Website
RRID:Addgene_157641 sMHT(1-113) Kanamycin PMID:33104325 Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-29 12:57:58 0
pDH003
 
Resource Report
Resource Website
RRID:Addgene_157640 sMHT(1-113)-SYNZIP17 Kanamycin PMID:33104325 Vector Backbone:pET28b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-29 12:57:58 0
pCMV Aquamarine
 
Resource Report
Resource Website
RRID:Addgene_157777 Kanamycin PMID:31317736 Backbone Marker:Clontech; Backbone Size:3939; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-29 12:58:00 0
pmGFP-Sec16L
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_15776 Sec16L Homo sapiens Kanamycin PMID:17192411 Please note that we have identified a K466R missense mutation in the Sec16L/Sec16A region of this plasmid, and the start codon may not have been correctly identified when constructing this plasmid which may have resulted in the gene being truncated. However, we do not think that this should impact plasmid functionality. Backbone Marker:Glick Lab; Backbone Size:4731; Vector Backbone:pmGFP-c1 ( modified from pEGFP-c1); Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin K466R 2026-08-29 12:58:00 4
pmGFP-Sec16S
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_15775 Sec16S Homo sapiens Kanamycin PMID:17192411 Backbone Marker:Glick Lab; Backbone Size:4731; Vector Backbone:pmGFPc1( modified from pEGFP-c1); Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin N/A 2026-08-29 12:58:00 3
pelBHisTEV
 
Resource Report
Resource Website
RRID:Addgene_157741 Kanamycin - Empty vector (kanamycin-R) adds TEV-protease-removable N-terminal PelB signal sequence + His10, plus potential C-term His6. Non-leaky expression due to T7lac promoter. - Has an advantage in leaving no added amino acid residues following TEV protease cleavage of PelB signal sequence + His10. This advantage is made possible by cloning into the two BseRI restriction sites. - Subcloning requires ligation-independent cloning and use of the two BseRI restriction sites that are present in this empty vector. The two BseRI sites span a removable 432 nucleotide sequence. Cloning into the BseRI-digested vector can be achieved using a ligation-independent system that is dependent on homologous recombination, such as the Takara In-Fusion HD Cloning Plus system, which requires simply designing the PCR-derived insert (containing the protein of interest) to contain 15 bp at each end that matches the 15 bp at each end of the linearized parent vector. In other words, add these 15 bp, AACCTGTACTTCCAA, to the 5' end of the PCR FORWARD primer, and add these 15 bp, GTGGTGGTGCTCGAG, to the 5' end of the PCR REVERSE primer. - The sequence of the added N-terminus is the PelB signal sequence (M1-A22 of GenBank #AAA24848) + 13 aa linker + His10-tag + 4 aa linker + TEV protease cleavage site. The N-terminal protein sequence is: MKYLLPTAAAGLLLLAAQPAMA + MDIGINSDPNSSS + HHHHHHHHHH + PMGS + ENLYFQ*X, where * is the TEV protease cleavage site and X is the N-terminal residue of the introduced protein of interest. Note that TEV protease cleaves most efficiently when X = S, G, A, M; for other compatible residues see Kapust et al 2002, PMID 12074568. - A C-terminal His6-tag is possible: if no stop codon is included in the cloned insert, the sequence LEHHHHHH is added to the C-terminus. - The PelB signal sequence directs the protein of interest to the E. coli inner membrane. Whether the protein traverses the inner membrane is dependent on the protein of interest. - BseRI cuts 8-10 nucleotides outside of its own recognition sequence and is a non-palindromic site. The placement & orientation of the two BseRI sites eliminates all of the BseRI recognition sequence in the resulting subclone. - To verify the PCR-generated insert sequence, use sequencing primers T7 (TAATACGACTCACTATAGGG), T7-Ter (GCTAGTTATTGCTCAGCGG). Backbone Size:5401; Vector Backbone:pelB-MBP (DNASU access. no. EvNO00813783); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-29 12:58:00 0
pEGFP N1 AURKA 1-110
 
Resource Report
Resource Website
RRID:Addgene_157755 AURKA Homo sapiens Kanamycin PMID:30070631 Backbone Marker:Clontech; Backbone Size:4733; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin The first 110 amino acids of AURKA were cloned 2026-08-29 12:58:00 0
pmCherry N1 TOMM22
 
Resource Report
Resource Website
RRID:Addgene_157762 TOMM22 Homo sapiens Kanamycin PMID:30070631 Backbone Marker:Clontech; Backbone Size:4722; Vector Backbone:pmCherry-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-29 12:58:00 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.