Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pYD1-mSA Resource Report Resource Website 1+ mentions |
RRID:Addgene_39865 | monomeric streptavidin | Synthetic | Ampicillin | PMID:22806584 | Backbone Marker:invitrogen; Vector Backbone:pYD1; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:32 | 6 | ||
|
pRSET-mSA Resource Report Resource Website 1+ mentions |
RRID:Addgene_39860 | monomeric streptavidin | Synthetic | Ampicillin | PMID:22806584 | Please note the YPet fluorescent protein present in the vector backbone is not expressed with the streptavidin insert. | Vector Backbone:pRSET-A; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:32 | 4 | |
|
pDisplay-mSA-EGFP-TM Resource Report Resource Website 1+ mentions |
RRID:Addgene_39863 | monomeric streptavidin, EGFP, TM helix | Synthetic | Ampicillin | PMID:22806584 | Backbone Marker:Life Technology; Vector Backbone:pDisplay; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:32 | 8 | ||
|
pRSET-mSA-EGFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_39862 | monomeric streptavidin fused to EGFP | Synthetic | Ampicillin | PMID:22806584 | Vector Backbone:pRSET-A; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:32 | 1 | ||
|
pBEST-OR2-OR1-Pr-UTR1-deGFP-T500 Resource Report Resource Website 10+ mentions |
RRID:Addgene_40019 | deGFP | Synthetic | Ampicillin | PMID:20576148 | Backbone Marker:Promega; Vector Backbone:pBEST-Luc; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:32 | 20 | ||
|
EKAR2G_design2_mTFP_227_Venus_157 Resource Report Resource Website |
RRID:Addgene_40015 | Erk activity reporter | Synthetic | Ampicillin | PMID:23882122 | A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49) | Backbone Marker:Novagen; Backbone Size:4900; Vector Backbone:pTriEx4; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:32 | 0 | |
|
EKAR2G_design2_mTFP_227_Venus_wt Resource Report Resource Website |
RRID:Addgene_40014 | Erk activity reporter | Synthetic | Ampicillin | PMID:23882122 | A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49) | Backbone Marker:Novagen; Backbone Size:4900; Vector Backbone:pTriEx4; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:32 | 0 | |
|
EKAR2G_design2_mTFP_159_Venus_195 Resource Report Resource Website |
RRID:Addgene_40007 | Erk activity reporter | Synthetic | Ampicillin | PMID:23882122 | A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49) | Backbone Marker:Novagen; Backbone Size:4900; Vector Backbone:pTriEx4; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:32 | 0 | |
|
EKAR2G_design2_mTFP_105_Venus_229 Resource Report Resource Website |
RRID:Addgene_40003 | Erk activity reporter | Synthetic | Ampicillin | PMID:23882122 | A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49) | Backbone Marker:Novagen; Backbone Size:4900; Vector Backbone:pTriEx4; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:32 | 0 | |
|
EKAR2G_design2_mTFP_105_Venus_195 Resource Report Resource Website |
RRID:Addgene_40002 | Erk activity reporter | Synthetic | Ampicillin | PMID:23882122 | A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49) | Backbone Marker:Novagen; Backbone Size:4900; Vector Backbone:pTriEx4; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:32 | 0 | |
|
EKAR2G_design2_mTFP_105_Venus_173 Resource Report Resource Website |
RRID:Addgene_40001 | Erk activity reporter | Synthetic | Ampicillin | PMID:23882122 | A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49) | Backbone Marker:Novagen; Backbone Size:4900; Vector Backbone:pTriEx4; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:32 | 0 | |
|
pLentiEKAR2G2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_40178 | Erk activity reporter | Synthetic | Ampicillin | PMID:23882122 | A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49) | Backbone Marker:unknown; Backbone Size:7711; Vector Backbone:pLenti pRRL-SV40(puro)_CMV(mcs); Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:34 | 3 | |
|
pTriExEKAR2G1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_40174 | Erk activity reporter | Synthetic | Ampicillin | PMID:23882122 | A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49) | Backbone Marker:Novagen; Backbone Size:4900; Vector Backbone:pTriEx4; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:34 | 1 | |
|
pET21b-LOV-ipaA Resource Report Resource Website 1+ mentions |
RRID:Addgene_40236 | LOV-ipaA | Synthetic | Ampicillin | PMID:22520757 | This vector encodes a photo-activable caged form of the vinculin binding ipaA peptide. Regarding the hybridized region, the first ten residues of the ipaA VBS1 helical peptide were identified as a close match to the last ten residues of the AsLOV2 Jα helix; five of the ten positions are identical, and the hydrophobic residues on the Jα helix that make critical contacts with the AsLOV2 domain beta-sheet at residues 539, 542, and 543 are conserved in the alignment with ipaA. Additionally, residues in the ipaA sequence that make extensive contacts with vinculin are conserved in the alignment (Ile 612, Ala 615, Ala 616, and Val 619 in ipaA). Side-chain optimization simulations were used to thread the first ten residues of ipaA onto the last ten residues of the Jα helix. The 540 position on the Jα helix was converted to isoleucine. The LOV-ipaA gene was synthesized with a six histidine N-terminal tag (Genscript, Piscataway, NJ, USA) and cloned into the pET21b vector. Protein coding sequence of LOV-ipaA: MHHHHHHGSLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTANNIIKAAKDVTTSLSKVLKNIN | Backbone Marker:EMD Biosciences; Backbone Size:5442; Vector Backbone:pET-21b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | Jα helix region hybridized (AsLOV2 aa 537-546/ipaA aa 610-619), residue 540 changed to isoleucine | 2026-08-15 01:14:34 | 1 |
|
pDDYFP-B Resource Report Resource Website |
RRID:Addgene_40289 | ddYFP-B | Synthetic | Ampicillin | PMID:23656278 | Backbone Marker:Invitrogen; Backbone Size:4100; Vector Backbone:pBad-modified; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 0 | ||
|
pDDGFP-B Resource Report Resource Website 1+ mentions |
RRID:Addgene_40287 | ddGFP-B | Synthetic | Ampicillin | PMID:23656278 | Backbone Marker:Invitrogen; Backbone Size:4100; Vector Backbone:pBad-modified; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 2 | ||
|
pcDNA3-Clover Resource Report Resource Website 10+ mentions |
RRID:Addgene_40259 | Clover GFP | Synthetic | Ampicillin | PMID:22961245 | Clover is the brightest green fluorescent protein (GFP) characterized to date, with robust performance in protein fusions. Also, it is useful as a FRET donor to mRuby2 in a FRET pair that offers bright fluorescence, dynamic range, and photostability while limiting emissions overlap. | Backbone Marker:Invitrogen; Backbone Size:5410; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 40 | |
|
pcDNA3.1/Puro-CAG-VSFP-CR Resource Report Resource Website 1+ mentions |
RRID:Addgene_40257 | VSFP-CR | Synthetic | Ampicillin | PMID:22961245 | Voltage sensor domain of Ci-VSP fused to a pair of fluorescent proteins consisting of a Clover GFP and mRuby2 RFP. | Backbone Marker:Invitrogen/Dr. Paulmurugan Ramasamy; Backbone Size:6107; Vector Backbone:pcDNA3.1/Puro-CAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 9 | |
|
pcDNA3-AKAR2-CR Resource Report Resource Website 1+ mentions |
RRID:Addgene_40255 | AKAR2 | Synthetic | Ampicillin | PMID:22961245 | ECFP was replaced with GFP Clover and Citrine was replaced with RFP mRuby2. Note: there is a small sequence insertion downstream of the insert that adds restriction sites. This is not present in the full plasmids sequence, so please refer to Addgene's QC sequence with the BGH-Rev primer for additional information. | Backbone Marker:Invitrogen; Backbone Size:5489; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 9 | |
|
pBACgus_Sumostar/LRRK2 1867-2161 Resource Report Resource Website |
RRID:Addgene_40391 | SUMO | Synthetic | Ampicillin | Backbone Marker:Novagen; Vector Backbone:pBACgus_SUMOstar; Vector Types:Baculovirus; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:36 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
