Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 43 showing 841 ~ 860 out of 2,244 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_78286

    This resource has 1+ mentions.

http://www.addgene.org/78286

Species: Arabidopsis thaliana
Genetic Insert: PAL2
Vector Backbone Description: Backbone Size:2999; Vector Backbone:pSTV28; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:21722749
Comments: *Note: Addgene's quality control sequencing finds an E50A amino acid residue substitution in the A. thaliana PAL2 gene insert. The depositing laboratory does not believe this residue change will affect protein function. This plasmid accurately reflects the construct as it was used in the associated publication.

Proper citation: RRID:Addgene_78286 Copy   


http://www.addgene.org/79135

Species: Arabidopsis thaliana
Genetic Insert: SD3(1-50)
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:11124; Vector Backbone:pMpGWB106; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:23421791

Proper citation: RRID:Addgene_79135 Copy   


  • RRID:Addgene_90511

http://www.addgene.org/90511

Species: Arabidopsis thaliana
Genetic Insert: PIF6-DBD
Vector Backbone Description: Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29301067
Comments: Plasmid contains amino acids 1-100 of PIF6 [NCBI NP_001327149.1].

Proper citation: RRID:Addgene_90511 Copy   


  • RRID:Addgene_90498

http://www.addgene.org/90498

Species: Arabidopsis thaliana
Genetic Insert: VP64-PIF3
Vector Backbone Description: Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29301067

Proper citation: RRID:Addgene_90498 Copy   


  • RRID:Addgene_90496

http://www.addgene.org/90496

Species: Arabidopsis thaliana
Genetic Insert: PhyB NT-MTAD
Vector Backbone Description: Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29301067

Proper citation: RRID:Addgene_90496 Copy   


http://www.addgene.org/64208

Species: Arabidopsis thaliana
Genetic Insert: Cry2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24920824

Proper citation: RRID:Addgene_64208 Copy   


http://www.addgene.org/64207

Species: Arabidopsis thaliana
Genetic Insert: Cry2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24920824

Proper citation: RRID:Addgene_64207 Copy   


http://www.addgene.org/64214

Species: Arabidopsis thaliana
Genetic Insert: Cry2 PHR
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24920824
Comments: PGK1 is cloned within the KpnI and XbaI sites

Proper citation: RRID:Addgene_64214 Copy   


  • RRID:Addgene_64805

http://www.addgene.org/64805

Species: Arabidopsis thaliana
Genetic Insert: CUC2
Vector Backbone Description: Vector Backbone:pGADT7; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25448000

Proper citation: RRID:Addgene_64805 Copy   


  • RRID:Addgene_64807

http://www.addgene.org/64807

Species: Arabidopsis thaliana
Genetic Insert: TCP4
Vector Backbone Description: Vector Backbone:pGADT7; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25448000

Proper citation: RRID:Addgene_64807 Copy   


  • RRID:Addgene_64808

http://www.addgene.org/64808

Species: Arabidopsis thaliana
Genetic Insert: CUC2
Vector Backbone Description: Vector Backbone:pGBKT7; Vector Types:; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25448000

Proper citation: RRID:Addgene_64808 Copy   


  • RRID:Addgene_64811

http://www.addgene.org/64811

Species: Arabidopsis thaliana
Genetic Insert: SPL9
Vector Backbone Description: Vector Backbone:pYES-DEST52; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25448000

Proper citation: RRID:Addgene_64811 Copy   


  • RRID:Addgene_64818

http://www.addgene.org/64818

Species: Arabidopsis thaliana
Genetic Insert: CUC3
Vector Backbone Description: Vector Backbone:JW772 (pCAMBIA2300); Vector Types:; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25448000

Proper citation: RRID:Addgene_64818 Copy   


  • RRID:Addgene_64817

http://www.addgene.org/64817

Species: Arabidopsis thaliana
Genetic Insert: CUC2
Vector Backbone Description: Vector Backbone:JW771 (pCAMBIA2300); Vector Types:; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25448000

Proper citation: RRID:Addgene_64817 Copy   


  • RRID:Addgene_67869

http://www.addgene.org/67869

Species: Arabidopsis thaliana
Genetic Insert: PRORP1
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:22976545
Comments: The mitochondrial targeting sequence “MLRLTCFTPSFSRACCPLFAMMLKVPSVHLHHPRF“ of native precursor PRORP1 was replaced with the dipeptide “MG”

Proper citation: RRID:Addgene_67869 Copy   


  • RRID:Addgene_67909

http://www.addgene.org/67909

Species: Arabidopsis thaliana
Genetic Insert: PIAL2
Vector Backbone Description: Backbone Marker:NEB; Backbone Size:6700; Vector Backbone:pMAL-c2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25415977

Proper citation: RRID:Addgene_67909 Copy   


  • RRID:Addgene_67911

http://www.addgene.org/67911

Species: Arabidopsis thaliana
Genetic Insert: Cold temperature germinating 10 (CTG10)
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:6494; Vector Backbone:pBD-GAL4 Cam; Vector Types:Yeast Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:29632208

Proper citation: RRID:Addgene_67911 Copy   


  • RRID:Addgene_67870

http://www.addgene.org/67870

Species: Arabidopsis thaliana
Genetic Insert: PRORP2
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:22976545

Proper citation: RRID:Addgene_67870 Copy   


  • RRID:Addgene_68256

http://www.addgene.org/68256

Species: Arabidopsis thaliana
Genetic Insert: Promoter_AtU6-26 + sgRNA_BolC.GA4a-2
Vector Backbone Description: Vector Backbone:pICH47761 (AddGene #48003); Vector Types:Plant Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26616834
Comments: Target sequence: GTTGAGAGGGGAGCCGGTGA

Proper citation: RRID:Addgene_68256 Copy   


  • RRID:Addgene_68261

    This resource has 1+ mentions.

http://www.addgene.org/68261

Species: Arabidopsis thaliana
Genetic Insert: Promoter: U6-26 (Arabidopsis thaliana)
Vector Backbone Description: Vector Backbone:pAGM9121; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:26616834

Proper citation: RRID:Addgene_68261 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X