Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Organism:arabidopsis thaliana (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

2,244 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pSpal2At
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_78286 PAL2 Arabidopsis thaliana Chloramphenicol PMID:21722749 *Note: Addgene's quality control sequencing finds an E50A amino acid residue substitution in the A. thaliana PAL2 gene insert. The depositing laboratory does not believe this residue change will affect protein function. This plasmid accurately reflects the construct as it was used in the associated publication. Backbone Size:2999; Vector Backbone:pSTV28; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol *see below 2026-08-15 01:20:23 2
pMpGWB106-MTS-Citrine
 
Resource Report
Resource Website 		RRID:Addgene_79135 SD3(1-50) Arabidopsis thaliana Spectinomycin PMID:23421791 Backbone Marker:Invitrogen; Backbone Size:11124; Vector Backbone:pMpGWB106; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin 2026-08-15 01:20:29 0
pPKm-196
 
Resource Report
Resource Website 		RRID:Addgene_90511 PIF6-DBD Arabidopsis thaliana Ampicillin PMID:29301067 Plasmid contains amino acids 1-100 of PIF6 [NCBI NP_001327149.1]. Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:22:07 0
pPKm- 227
 
Resource Report
Resource Website 		RRID:Addgene_90498 VP64-PIF3 Arabidopsis thaliana Ampicillin PMID:29301067 Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:22:07 0
pPKm-195
 
Resource Report
Resource Website 		RRID:Addgene_90496 PhyB NT-MTAD Arabidopsis thaliana Ampicillin PMID:29301067 Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:22:07 0
Cry2 mcherry Gamma 9 in pcDNA3.1
 
Resource Report
Resource Website 		RRID:Addgene_64208 Cry2 Arabidopsis thaliana Ampicillin PMID:24920824 Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:18:09 0
Cry2 mCherry RGS4(del 1-33) in pcDNA3.1
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_64207 Cry2 Arabidopsis thaliana Ampicillin PMID:24920824 Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:18:09 1
Cry2 mCherry PGK-1 in pcDNA3.1
 
Resource Report
Resource Website 		RRID:Addgene_64214 Cry2 PHR Arabidopsis thaliana Ampicillin PMID:24920824 PGK1 is cloned within the KpnI and XbaI sites Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:18:09 0
JW616
 
Resource Report
Resource Website 		RRID:Addgene_64805 CUC2 Arabidopsis thaliana Ampicillin PMID:25448000 Vector Backbone:pGADT7; Vector Types:; Bacterial Resistance:Ampicillin 2026-08-15 01:18:14 0
JW630
 
Resource Report
Resource Website 		RRID:Addgene_64807 TCP4 Arabidopsis thaliana Ampicillin PMID:25448000 Vector Backbone:pGADT7; Vector Types:; Bacterial Resistance:Ampicillin 2026-08-15 01:18:13 0
JW624
 
Resource Report
Resource Website 		RRID:Addgene_64808 CUC2 Arabidopsis thaliana Kanamycin PMID:25448000 Vector Backbone:pGBKT7; Vector Types:; Bacterial Resistance:Kanamycin 2026-08-15 01:18:13 0
pIR196
 
Resource Report
Resource Website 		RRID:Addgene_64811 SPL9 Arabidopsis thaliana Ampicillin PMID:25448000 Vector Backbone:pYES-DEST52; Vector Types:; Bacterial Resistance:Ampicillin 2026-08-15 01:18:13 0
JW777
 
Resource Report
Resource Website 		RRID:Addgene_64818 CUC3 Arabidopsis thaliana Kanamycin PMID:25448000 Vector Backbone:JW772 (pCAMBIA2300); Vector Types:; Bacterial Resistance:Kanamycin 2026-08-15 01:18:14 0
JW776
 
Resource Report
Resource Website 		RRID:Addgene_64817 CUC2 Arabidopsis thaliana Kanamycin PMID:25448000 Vector Backbone:JW771 (pCAMBIA2300); Vector Types:; Bacterial Resistance:Kanamycin rCUC2 2026-08-15 01:18:13 0
pET28-At_PRORP1-His
 
Resource Report
Resource Website 		RRID:Addgene_67869 PRORP1 Arabidopsis thaliana Kanamycin PMID:22976545 The mitochondrial targeting sequence “MLRLTCFTPSFSRACCPLFAMMLKVPSVHLHHPRF“ of native precursor PRORP1 was replaced with the dipeptide “MG” Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin Residues 36-572 (see comments) 2026-08-15 01:18:39 0
pMAL-PIAL2M-wt
 
Resource Report
Resource Website 		RRID:Addgene_67909 PIAL2 Arabidopsis thaliana Ampicillin PMID:25415977 Backbone Marker:NEB; Backbone Size:6700; Vector Backbone:pMAL-c2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin E281-A496 2026-08-15 01:18:43 0
pABD823
 
Resource Report
Resource Website 		RRID:Addgene_67911 Cold temperature germinating 10 (CTG10) Arabidopsis thaliana Chloramphenicol PMID:29632208 Backbone Marker:Stratagene; Backbone Size:6494; Vector Backbone:pBD-GAL4 Cam; Vector Types:Yeast Expression; Bacterial Resistance:Chloramphenicol 2026-08-15 01:18:39 0
pET28-At_PRORP2-His
 
Resource Report
Resource Website 		RRID:Addgene_67870 PRORP2 Arabidopsis thaliana Kanamycin PMID:22976545 Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:18:39 0
pICSL11062
 
Resource Report
Resource Website 		RRID:Addgene_68256 Promoter_AtU6-26 + sgRNA_BolC.GA4a-2 Arabidopsis thaliana Ampicillin PMID:26616834 Target sequence: GTTGAGAGGGGAGCCGGTGA Vector Backbone:pICH47761 (AddGene #48003); Vector Types:Plant Expression, Synthetic Biology; Bacterial Resistance:Ampicillin 2026-08-15 01:18:41 0
pICSL90002
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_68261 Promoter: U6-26 (Arabidopsis thaliana) Arabidopsis thaliana Spectinomycin PMID:26616834 Vector Backbone:pAGM9121; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin 2026-08-15 01:18:42 6

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch