Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 431 showing 8601 ~ 8620 out of 33,912 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_67848

    This resource has 1+ mentions.

http://www.addgene.org/67848

Species: Homo sapiens
Genetic Insert: oxytocin receptor
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24248349

Proper citation: RRID:Addgene_67848 Copy   


  • RRID:Addgene_67843

http://www.addgene.org/67843

Species: Homo sapiens
Genetic Insert: antibody 1D8 light kappa chain
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5260; Vector Backbone:modified pET-30a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26219832

Proper citation: RRID:Addgene_67843 Copy   


  • RRID:Addgene_67904

    This resource has 1+ mentions.

http://www.addgene.org/67904

Species: Synthetic
Genetic Insert: ECFP(W66A)-FRB-MoA
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26435194

Proper citation: RRID:Addgene_67904 Copy   


  • RRID:Addgene_67869

http://www.addgene.org/67869

Species: Arabidopsis thaliana
Genetic Insert: PRORP1
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:22976545
Comments: The mitochondrial targeting sequence “MLRLTCFTPSFSRACCPLFAMMLKVPSVHLHHPRF“ of native precursor PRORP1 was replaced with the dipeptide “MG”

Proper citation: RRID:Addgene_67869 Copy   


  • RRID:Addgene_67900

    This resource has 1+ mentions.

http://www.addgene.org/67900

Species: Synthetic
Genetic Insert: mCherry-FKBP12
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26435194

Proper citation: RRID:Addgene_67900 Copy   


http://www.addgene.org/67901

Species: Synthetic
Genetic Insert: mCherry-FKBP12-DH
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26435194

Proper citation: RRID:Addgene_67901 Copy   


  • RRID:Addgene_67866

http://www.addgene.org/67866

Species: Homo sapiens
Genetic Insert: MRPP3
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:23042678

Proper citation: RRID:Addgene_67866 Copy   


  • RRID:Addgene_67863

http://www.addgene.org/67863

Species: Homo sapiens
Genetic Insert: HADH2
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:18984158

Proper citation: RRID:Addgene_67863 Copy   


  • RRID:Addgene_67864

http://www.addgene.org/67864

Species: Homo sapiens
Genetic Insert: MRPP3
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:18984158

Proper citation: RRID:Addgene_67864 Copy   


  • RRID:Addgene_67870

http://www.addgene.org/67870

Species: Arabidopsis thaliana
Genetic Insert: PRORP2
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:22976545

Proper citation: RRID:Addgene_67870 Copy   


  • RRID:Addgene_67920

http://www.addgene.org/67920

Species: Rattus norvegicus
Genetic Insert: Rattus norvegicus aldehyde dehydrogenase
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5232; Vector Backbone:pET29b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin

Proper citation: RRID:Addgene_67920 Copy   


  • RRID:Addgene_67937

    This resource has 1+ mentions.

http://www.addgene.org/67937

Species: Mus musculus
Genetic Insert: E-cadherin
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24652832

Proper citation: RRID:Addgene_67937 Copy   


http://www.addgene.org/67936

Species: Mus musculus
Genetic Insert: alpha E catenin
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25065757
Comments: FP4 motif is from Listeria-ActA and fused to the N terminal domain of alpha catenin and recruits Ena/VASP.

Proper citation: RRID:Addgene_67936 Copy   


  • RRID:Addgene_67898

    This resource has 1+ mentions.

http://www.addgene.org/67898

Species: Synthetic
Genetic Insert: mCherry-DH
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26435194

Proper citation: RRID:Addgene_67898 Copy   


  • RRID:Addgene_67897

http://www.addgene.org/67897

Species: Synthetic
Genetic Insert: mCherry-pmDH
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26435194

Proper citation: RRID:Addgene_67897 Copy   


  • RRID:Addgene_67894

    This resource has 1+ mentions.

http://www.addgene.org/67894

Species: Mus musculus
Genetic Insert: mVenus-MKL2
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26435194

Proper citation: RRID:Addgene_67894 Copy   


  • RRID:Addgene_68126

    This resource has 1+ mentions.

http://www.addgene.org/68126

Species: Synthetic
Genetic Insert: oxBFP
Vector Backbone Description: Backbone Marker:Snapp et al. PMID 16617114, Addgene plasmid 62236; Vector Backbone:ER-mRFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26158227

Proper citation: RRID:Addgene_68126 Copy   


  • RRID:Addgene_68133

    This resource has 1+ mentions.

http://www.addgene.org/68133

Species: Homo sapiens
Genetic Insert: Polo-like kinase 1
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin

Proper citation: RRID:Addgene_68133 Copy   


  • RRID:Addgene_68132

    This resource has 1+ mentions.

http://www.addgene.org/68132

Species: Homo sapiens
Genetic Insert: Polo-like kinase 1
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:5700; Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin

Proper citation: RRID:Addgene_68132 Copy   


  • RRID:Addgene_68027

    This resource has 1+ mentions.

http://www.addgene.org/68027

Species: Homo sapiens
Genetic Insert: Anillin
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:18158243

Proper citation: RRID:Addgene_68027 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X