Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
hOT-GFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_67848 | oxytocin receptor | Homo sapiens | Kanamycin | PMID:24248349 | Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-29 01:09:12 | 1 | ||
|
pET-scFv-T Resource Report Resource Website |
RRID:Addgene_67843 | antibody 1D8 light kappa chain | Homo sapiens | Kanamycin | PMID:26219832 | Backbone Marker:Novagen; Backbone Size:5260; Vector Backbone:modified pET-30a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-29 01:09:12 | 0 | ||
|
ECFP(W66A)-FRB-MoA Resource Report Resource Website 1+ mentions |
RRID:Addgene_67904 | ECFP(W66A)-FRB-MoA | Synthetic | Kanamycin | PMID:26435194 | Backbone Marker:Clontech; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-29 01:09:12 | 2 | ||
|
pET28-At_PRORP1-His Resource Report Resource Website |
RRID:Addgene_67869 | PRORP1 | Arabidopsis thaliana | Kanamycin | PMID:22976545 | The mitochondrial targeting sequence “MLRLTCFTPSFSRACCPLFAMMLKVPSVHLHHPRF“ of native precursor PRORP1 was replaced with the dipeptide “MG” | Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Residues 36-572 (see comments) | 2026-08-29 01:09:12 | 0 |
|
pmCherry-FKBP12-C1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_67900 | mCherry-FKBP12 | Synthetic | Kanamycin | PMID:26435194 | Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-29 01:09:12 | 2 | ||
|
pmCherry-FKBP12-C1-DH Resource Report Resource Website |
RRID:Addgene_67901 | mCherry-FKBP12-DH | Synthetic | Kanamycin | PMID:26435194 | Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Kanamycin | 2026-08-29 01:09:12 | 0 | ||
|
pET28-MRPP3-His Resource Report Resource Website |
RRID:Addgene_67866 | MRPP3 | Homo sapiens | Kanamycin | PMID:23042678 | Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Amino acid 46 of recombinant MRPP3 is preceded by Met-Gly | 2026-08-29 01:09:12 | 0 | |
|
pET28-HADH2 Resource Report Resource Website |
RRID:Addgene_67863 | HADH2 | Homo sapiens | Kanamycin | PMID:18984158 | Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-29 01:09:12 | 0 | ||
|
pET28-MRPP3-myc-His Resource Report Resource Website |
RRID:Addgene_67864 | MRPP3 | Homo sapiens | Kanamycin | PMID:18984158 | Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Amino acid 46 of recombinant MRPP3 is preceded by Met-Gly | 2026-08-29 01:09:12 | 0 | |
|
pET28-At_PRORP2-His Resource Report Resource Website |
RRID:Addgene_67870 | PRORP2 | Arabidopsis thaliana | Kanamycin | PMID:22976545 | Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-29 01:09:12 | 0 | ||
|
rnALDH Resource Report Resource Website |
RRID:Addgene_67920 | Rattus norvegicus aldehyde dehydrogenase | Rattus norvegicus | Kanamycin | Backbone Marker:Novagen; Backbone Size:5232; Vector Backbone:pET29b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-29 01:09:12 | 0 | |||
|
mouse E-cadherin GFP (423) Resource Report Resource Website 1+ mentions |
RRID:Addgene_67937 | E-cadherin | Mus musculus | Kanamycin | PMID:24652832 | Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-29 01:09:12 | 3 | ||
|
GFP-alpha-E-Catenin 3xFP4 (895) Resource Report Resource Website 1+ mentions |
RRID:Addgene_67936 | alpha E catenin | Mus musculus | Kanamycin | PMID:25065757 | FP4 motif is from Listeria-ActA and fused to the N terminal domain of alpha catenin and recruits Ena/VASP. | Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | N-terminal domain | 2026-08-29 01:09:12 | 1 |
|
pmCherry-C1-DH Resource Report Resource Website 1+ mentions |
RRID:Addgene_67898 | mCherry-DH | Synthetic | Kanamycin | PMID:26435194 | Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-29 01:09:12 | 1 | ||
|
pmCherry-C1-pmDH Resource Report Resource Website |
RRID:Addgene_67897 | mCherry-pmDH | Synthetic | Kanamycin | PMID:26435194 | Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-29 01:09:12 | 0 | ||
|
pmVenus-C2-MmMKL2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_67894 | mVenus-MKL2 | Mus musculus | Kanamycin | PMID:26435194 | Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-29 01:09:12 | 1 | ||
|
ERoxBFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_68126 | oxBFP | Synthetic | Kanamycin | PMID:26158227 | Backbone Marker:Snapp et al. PMID 16617114, Addgene plasmid 62236; Vector Backbone:ER-mRFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-29 01:09:13 | 6 | ||
|
pCer-C3-Plk1-T210D Resource Report Resource Website 1+ mentions |
RRID:Addgene_68133 | Polo-like kinase 1 | Homo sapiens | Kanamycin | Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | T210D constitutively active version | 2026-08-29 01:09:13 | 2 | ||
|
pCer-C3-Plk1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_68132 | Polo-like kinase 1 | Homo sapiens | Kanamycin | Backbone Marker:Clontech; Backbone Size:5700; Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | wild-type | 2026-08-29 01:09:13 | 3 | ||
|
pEGFP-Anillin Resource Report Resource Website 1+ mentions |
RRID:Addgene_68027 | Anillin | Homo sapiens | Kanamycin | PMID:18158243 | Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | silent mutations at 798 5'-TGCC TCTTTGAATAAA-3' 814 to 5' -CGCAAGCTTAAACAAG-3' for RNAi resistance. D278A | 2026-08-29 01:09:13 | 2 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.