Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Bacterial Resistance:kanamycin (facet)


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

33,912 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
hOT-GFP
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_67848 oxytocin receptor Homo sapiens Kanamycin PMID:24248349 Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-29 01:09:12 1
pET-scFv-T
 
Resource Report
Resource Website
RRID:Addgene_67843 antibody 1D8 light kappa chain Homo sapiens Kanamycin PMID:26219832 Backbone Marker:Novagen; Backbone Size:5260; Vector Backbone:modified pET-30a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-29 01:09:12 0
ECFP(W66A)-FRB-MoA
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_67904 ECFP(W66A)-FRB-MoA Synthetic Kanamycin PMID:26435194 Backbone Marker:Clontech; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-29 01:09:12 2
pET28-At_PRORP1-His
 
Resource Report
Resource Website
RRID:Addgene_67869 PRORP1 Arabidopsis thaliana Kanamycin PMID:22976545 The mitochondrial targeting sequence “MLRLTCFTPSFSRACCPLFAMMLKVPSVHLHHPRF“ of native precursor PRORP1 was replaced with the dipeptide “MG” Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin Residues 36-572 (see comments) 2026-08-29 01:09:12 0
pmCherry-FKBP12-C1
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_67900 mCherry-FKBP12 Synthetic Kanamycin PMID:26435194 Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-29 01:09:12 2
pmCherry-FKBP12-C1-DH
 
Resource Report
Resource Website
RRID:Addgene_67901 mCherry-FKBP12-DH Synthetic Kanamycin PMID:26435194 Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Kanamycin 2026-08-29 01:09:12 0
pET28-MRPP3-His
 
Resource Report
Resource Website
RRID:Addgene_67866 MRPP3 Homo sapiens Kanamycin PMID:23042678 Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin Amino acid 46 of recombinant MRPP3 is preceded by Met-Gly 2026-08-29 01:09:12 0
pET28-HADH2
 
Resource Report
Resource Website
RRID:Addgene_67863 HADH2 Homo sapiens Kanamycin PMID:18984158 Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-29 01:09:12 0
pET28-MRPP3-myc-His
 
Resource Report
Resource Website
RRID:Addgene_67864 MRPP3 Homo sapiens Kanamycin PMID:18984158 Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin Amino acid 46 of recombinant MRPP3 is preceded by Met-Gly 2026-08-29 01:09:12 0
pET28-At_PRORP2-His
 
Resource Report
Resource Website
RRID:Addgene_67870 PRORP2 Arabidopsis thaliana Kanamycin PMID:22976545 Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-29 01:09:12 0
rnALDH
 
Resource Report
Resource Website
RRID:Addgene_67920 Rattus norvegicus aldehyde dehydrogenase Rattus norvegicus Kanamycin Backbone Marker:Novagen; Backbone Size:5232; Vector Backbone:pET29b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-29 01:09:12 0
mouse E-cadherin GFP (423)
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_67937 E-cadherin Mus musculus Kanamycin PMID:24652832 Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-29 01:09:12 3
GFP-alpha-E-Catenin 3xFP4 (895)
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_67936 alpha E catenin Mus musculus Kanamycin PMID:25065757 FP4 motif is from Listeria-ActA and fused to the N terminal domain of alpha catenin and recruits Ena/VASP. Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin N-terminal domain 2026-08-29 01:09:12 1
pmCherry-C1-DH
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_67898 mCherry-DH Synthetic Kanamycin PMID:26435194 Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-29 01:09:12 1
pmCherry-C1-pmDH
 
Resource Report
Resource Website
RRID:Addgene_67897 mCherry-pmDH Synthetic Kanamycin PMID:26435194 Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-29 01:09:12 0
pmVenus-C2-MmMKL2
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_67894 mVenus-MKL2 Mus musculus Kanamycin PMID:26435194 Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-29 01:09:12 1
ERoxBFP
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_68126 oxBFP Synthetic Kanamycin PMID:26158227 Backbone Marker:Snapp et al. PMID 16617114, Addgene plasmid 62236; Vector Backbone:ER-mRFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-29 01:09:13 6
pCer-C3-Plk1-T210D
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_68133 Polo-like kinase 1 Homo sapiens Kanamycin Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin T210D constitutively active version 2026-08-29 01:09:13 2
pCer-C3-Plk1
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_68132 Polo-like kinase 1 Homo sapiens Kanamycin Backbone Marker:Clontech; Backbone Size:5700; Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin wild-type 2026-08-29 01:09:13 3
pEGFP-Anillin
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_68027 Anillin Homo sapiens Kanamycin PMID:18158243 Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin silent mutations at 798 5'-TGCC TCTTTGAATAAA-3' 814 to 5' -CGCAAGCTTAAACAAG-3' for RNAi resistance. D278A 2026-08-29 01:09:13 2

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.