Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 438 showing 8741 ~ 8760 out of 69,655 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_119003

http://www.addgene.org/119003

Species: Homo sapiens
Genetic Insert: Rad18
Vector Backbone Description: Backbone Size:2961; Vector Backbone:Bluescript; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33097066

Proper citation: RRID:Addgene_119003 Copy   


  • RRID:Addgene_119004

http://www.addgene.org/119004

Species: Homo sapiens
Genetic Insert: RNF169
Vector Backbone Description: Backbone Size:2961; Vector Backbone:Bluescript; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33097066

Proper citation: RRID:Addgene_119004 Copy   


  • RRID:Addgene_118943

    This resource has 1+ mentions.

http://www.addgene.org/118943

Species: Homo sapiens
Genetic Insert: iRFP682-Smad2
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:piRFP682-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29241005

Proper citation: RRID:Addgene_118943 Copy   


  • RRID:Addgene_118986

http://www.addgene.org/118986

Species: Homo sapiens
Genetic Insert: c-kit proto-oncogene {promoter}
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31244182

Proper citation: RRID:Addgene_118986 Copy   


  • RRID:Addgene_118985

http://www.addgene.org/118985

Species: Homo sapiens
Genetic Insert: c-kit proto-oncogene {promoter}
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31244182

Proper citation: RRID:Addgene_118985 Copy   


  • RRID:Addgene_118988

http://www.addgene.org/118988

Species: Homo sapiens
Genetic Insert: c-kit proto-oncogene {promoter}
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31244182

Proper citation: RRID:Addgene_118988 Copy   


  • RRID:Addgene_118987

http://www.addgene.org/118987

Species: Homo sapiens
Genetic Insert: c-kit proto-oncogene {promoter}
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31244182

Proper citation: RRID:Addgene_118987 Copy   


  • RRID:Addgene_118989

http://www.addgene.org/118989

Species: Homo sapiens
Genetic Insert: c-kit proto-oncogene {promoter}
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31244182

Proper citation: RRID:Addgene_118989 Copy   


  • RRID:Addgene_119139

http://www.addgene.org/119139

Species: Homo sapiens
Genetic Insert: APOBEC3G-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582

Proper citation: RRID:Addgene_119139 Copy   


  • RRID:Addgene_119138

http://www.addgene.org/119138

Species: Homo sapiens
Genetic Insert: APOBEC3F-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582

Proper citation: RRID:Addgene_119138 Copy   


  • RRID:Addgene_119135

http://www.addgene.org/119135

Species: Homo sapiens
Genetic Insert: APOBEC3B L1 intron-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582

Proper citation: RRID:Addgene_119135 Copy   


  • RRID:Addgene_119136

http://www.addgene.org/119136

Species: Homo sapiens
Genetic Insert: APOBEC3C-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582

Proper citation: RRID:Addgene_119136 Copy   


http://www.addgene.org/119142

Species: Homo sapiens
Genetic Insert: APOBEC3H Haplotype II RR175/6EE-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582

Proper citation: RRID:Addgene_119142 Copy   


  • RRID:Addgene_119141

http://www.addgene.org/119141

Species: Homo sapiens
Genetic Insert: APOBEC3H Haplotype II-Cas9 nickase-UGI
Vector Backbone Description: Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30679582

Proper citation: RRID:Addgene_119141 Copy   


  • RRID:Addgene_119126

http://www.addgene.org/119126

Species: Homo sapiens
Genetic Insert: RICS-PX (127-255)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Comments: Amino Acid Sequence: NVEFGSIQLSLSEEQNEVMKNGCESKELVYLVQIACQGKSWIVKRSYEDFRVLDKHLHLCIYDRRFSQLSELPRSDTLKDSPESVTQMLMAYLSRLSAIAGNKINCGPALTWMEIDNKGNHLLVHEESS

Proper citation: RRID:Addgene_119126 Copy   


  • RRID:Addgene_119124

http://www.addgene.org/119124

Species: Homo sapiens
Genetic Insert: p47phox-PX (1-122)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Comments: Amino Acid Sequence: MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCGTLMSLPTKISRCPHLLDFFKVRP

Proper citation: RRID:Addgene_119124 Copy   


  • RRID:Addgene_119089

http://www.addgene.org/119089

Species: Homo sapiens
Genetic Insert: SNX8-PX (70-190)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Comments: Amino Acid Sequence: ELLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGADREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGSDVQNKLKESA

Proper citation: RRID:Addgene_119089 Copy   


  • RRID:Addgene_119098

http://www.addgene.org/119098

Species: Homo sapiens
Genetic Insert: SNX17-PX (1-111)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Comments: Amino Acid Sequence: MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFPPKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQ

Proper citation: RRID:Addgene_119098 Copy   


  • RRID:Addgene_119096

http://www.addgene.org/119096

Species: Homo sapiens
Genetic Insert: SNX15-PX (1-127)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Comments: Amino Acid Sequence: MSRQAKDDFLRHYTVSDPRTHPKGYTEYKVTAQFISKKDPEDVKEVVVWKRYSDFRKLHGDLAYTHRNLFRRLEEFPAFPRAQVFGRFEASVIEERRKGAEDLLRFTVHIPALNNSPQLKEFFRGG

Proper citation: RRID:Addgene_119096 Copy   


  • RRID:Addgene_119092

http://www.addgene.org/119092

Species: Homo sapiens
Genetic Insert: SNX11-PX (7-167)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30948714
Comments: Amino Acid Sequence: MSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQ

Proper citation: RRID:Addgene_119092 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X