Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Organism:homo sapiens (facet)


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

69,655 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
pCAG-Rad18
 
Resource Report
Resource Website
RRID:Addgene_119003 Rad18 Homo sapiens Ampicillin PMID:33097066 Backbone Size:2961; Vector Backbone:Bluescript; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:03 0
pCAG-RNF169
 
Resource Report
Resource Website
RRID:Addgene_119004 RNF169 Homo sapiens Ampicillin PMID:33097066 Backbone Size:2961; Vector Backbone:Bluescript; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:00 0
iRFP682-Smad2
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_118943 iRFP682-Smad2 Homo sapiens Kanamycin PMID:29241005 Backbone Marker:Clontech; Vector Backbone:piRFP682-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-29 12:53:03 2
pC-KIT4
 
Resource Report
Resource Website
RRID:Addgene_118986 c-kit proto-oncogene {promoter} Homo sapiens Ampicillin PMID:31244182 Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin K2-SP-mutK1 2026-08-29 12:53:03 0
pC-KIT3
 
Resource Report
Resource Website
RRID:Addgene_118985 c-kit proto-oncogene {promoter} Homo sapiens Ampicillin PMID:31244182 Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin K2-mutSP-K1 2026-08-29 12:53:00 0
pC-KIT6
 
Resource Report
Resource Website
RRID:Addgene_118988 c-kit proto-oncogene {promoter} Homo sapiens Ampicillin PMID:31244182 Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin mutK2-SP-mutK1 2026-08-29 12:53:00 0
pC-KIT5
 
Resource Report
Resource Website
RRID:Addgene_118987 c-kit proto-oncogene {promoter} Homo sapiens Ampicillin PMID:31244182 Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin mutK2-mutSP-K1 2026-08-29 12:53:00 0
pC-KIT7
 
Resource Report
Resource Website
RRID:Addgene_118989 c-kit proto-oncogene {promoter} Homo sapiens Ampicillin PMID:31244182 Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin K2-mutSP-mutK1 2026-08-29 12:53:03 0
A3G-Cas9n-UGI
 
Resource Report
Resource Website
RRID:Addgene_119139 APOBEC3G-Cas9 nickase-UGI Homo sapiens Ampicillin PMID:30679582 Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin None 2026-08-29 12:53:04 0
A3F-Cas9n-UGI
 
Resource Report
Resource Website
RRID:Addgene_119138 APOBEC3F-Cas9 nickase-UGI Homo sapiens Ampicillin PMID:30679582 Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin None 2026-08-29 12:53:02 0
A3Bi-Cas9n-UGI
 
Resource Report
Resource Website
RRID:Addgene_119135 APOBEC3B L1 intron-Cas9 nickase-UGI Homo sapiens Ampicillin PMID:30679582 Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin L1 intron insertion 2026-08-29 12:53:02 0
A3C-Cas9n-UGI
 
Resource Report
Resource Website
RRID:Addgene_119136 APOBEC3C-Cas9 nickase-UGI Homo sapiens Ampicillin PMID:30679582 Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin None 2026-08-29 12:53:04 0
A3H HapII R175/6E-Cas9n-UGI
 
Resource Report
Resource Website
RRID:Addgene_119142 APOBEC3H Haplotype II RR175/6EE-Cas9 nickase-UGI Homo sapiens Ampicillin PMID:30679582 Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin A3H Hap II RR175/6EE 2026-08-29 12:53:02 0
A3H HapII-Cas9n-UGI
 
Resource Report
Resource Website
RRID:Addgene_119141 APOBEC3H Haplotype II-Cas9 nickase-UGI Homo sapiens Ampicillin PMID:30679582 Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin None 2026-08-29 12:53:04 0
RICS-PX (127-255)
 
Resource Report
Resource Website
RRID:Addgene_119126 RICS-PX (127-255) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: NVEFGSIQLSLSEEQNEVMKNGCESKELVYLVQIACQGKSWIVKRSYEDFRVLDKHLHLCIYDRRFSQLSELPRSDTLKDSPESVTQMLMAYLSRLSAIAGNKINCGPALTWMEIDNKGNHLLVHEESS Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:04 0
p47phox-PX (1-122)
 
Resource Report
Resource Website
RRID:Addgene_119124 p47phox-PX (1-122) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCGTLMSLPTKISRCPHLLDFFKVRP Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:02 0
SNX8-PX (70-190)
 
Resource Report
Resource Website
RRID:Addgene_119089 SNX8-PX (70-190) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: ELLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGADREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGSDVQNKLKESA Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:01 0
SNX17-PX (1-111)
 
Resource Report
Resource Website
RRID:Addgene_119098 SNX17-PX (1-111) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFPPKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQ Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:03 0
SNX15-PX (1-127)
 
Resource Report
Resource Website
RRID:Addgene_119096 SNX15-PX (1-127) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: MSRQAKDDFLRHYTVSDPRTHPKGYTEYKVTAQFISKKDPEDVKEVVVWKRYSDFRKLHGDLAYTHRNLFRRLEEFPAFPRAQVFGRFEASVIEERRKGAEDLLRFTVHIPALNNSPQLKEFFRGG Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:01 0
SNX11-PX (7-167)
 
Resource Report
Resource Website
RRID:Addgene_119092 SNX11-PX (7-167) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: MSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQ Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:03 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.