Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pCAG-Rad18 Resource Report Resource Website |
RRID:Addgene_119003 | Rad18 | Homo sapiens | Ampicillin | PMID:33097066 | Backbone Size:2961; Vector Backbone:Bluescript; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:03 | 0 | ||
|
pCAG-RNF169 Resource Report Resource Website |
RRID:Addgene_119004 | RNF169 | Homo sapiens | Ampicillin | PMID:33097066 | Backbone Size:2961; Vector Backbone:Bluescript; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:00 | 0 | ||
|
iRFP682-Smad2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_118943 | iRFP682-Smad2 | Homo sapiens | Kanamycin | PMID:29241005 | Backbone Marker:Clontech; Vector Backbone:piRFP682-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-29 12:53:03 | 2 | ||
|
pC-KIT4 Resource Report Resource Website |
RRID:Addgene_118986 | c-kit proto-oncogene {promoter} | Homo sapiens | Ampicillin | PMID:31244182 | Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | K2-SP-mutK1 | 2026-08-29 12:53:03 | 0 | |
|
pC-KIT3 Resource Report Resource Website |
RRID:Addgene_118985 | c-kit proto-oncogene {promoter} | Homo sapiens | Ampicillin | PMID:31244182 | Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | K2-mutSP-K1 | 2026-08-29 12:53:00 | 0 | |
|
pC-KIT6 Resource Report Resource Website |
RRID:Addgene_118988 | c-kit proto-oncogene {promoter} | Homo sapiens | Ampicillin | PMID:31244182 | Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | mutK2-SP-mutK1 | 2026-08-29 12:53:00 | 0 | |
|
pC-KIT5 Resource Report Resource Website |
RRID:Addgene_118987 | c-kit proto-oncogene {promoter} | Homo sapiens | Ampicillin | PMID:31244182 | Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | mutK2-mutSP-K1 | 2026-08-29 12:53:00 | 0 | |
|
pC-KIT7 Resource Report Resource Website |
RRID:Addgene_118989 | c-kit proto-oncogene {promoter} | Homo sapiens | Ampicillin | PMID:31244182 | Backbone Marker:Promega; Backbone Size:5589; Vector Backbone:psiCHEK2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | K2-mutSP-mutK1 | 2026-08-29 12:53:03 | 0 | |
|
A3G-Cas9n-UGI Resource Report Resource Website |
RRID:Addgene_119139 | APOBEC3G-Cas9 nickase-UGI | Homo sapiens | Ampicillin | PMID:30679582 | Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | None | 2026-08-29 12:53:04 | 0 | |
|
A3F-Cas9n-UGI Resource Report Resource Website |
RRID:Addgene_119138 | APOBEC3F-Cas9 nickase-UGI | Homo sapiens | Ampicillin | PMID:30679582 | Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | None | 2026-08-29 12:53:02 | 0 | |
|
A3Bi-Cas9n-UGI Resource Report Resource Website |
RRID:Addgene_119135 | APOBEC3B L1 intron-Cas9 nickase-UGI | Homo sapiens | Ampicillin | PMID:30679582 | Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | L1 intron insertion | 2026-08-29 12:53:02 | 0 | |
|
A3C-Cas9n-UGI Resource Report Resource Website |
RRID:Addgene_119136 | APOBEC3C-Cas9 nickase-UGI | Homo sapiens | Ampicillin | PMID:30679582 | Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | None | 2026-08-29 12:53:04 | 0 | |
|
A3H HapII R175/6E-Cas9n-UGI Resource Report Resource Website |
RRID:Addgene_119142 | APOBEC3H Haplotype II RR175/6EE-Cas9 nickase-UGI | Homo sapiens | Ampicillin | PMID:30679582 | Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | A3H Hap II RR175/6EE | 2026-08-29 12:53:02 | 0 | |
|
A3H HapII-Cas9n-UGI Resource Report Resource Website |
RRID:Addgene_119141 | APOBEC3H Haplotype II-Cas9 nickase-UGI | Homo sapiens | Ampicillin | PMID:30679582 | Backbone Marker:Liu Lab; Backbone Size:7825; Vector Backbone:BE3; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | None | 2026-08-29 12:53:04 | 0 | |
|
RICS-PX (127-255) Resource Report Resource Website |
RRID:Addgene_119126 | RICS-PX (127-255) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: NVEFGSIQLSLSEEQNEVMKNGCESKELVYLVQIACQGKSWIVKRSYEDFRVLDKHLHLCIYDRRFSQLSELPRSDTLKDSPESVTQMLMAYLSRLSAIAGNKINCGPALTWMEIDNKGNHLLVHEESS | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:04 | 0 | |
|
p47phox-PX (1-122) Resource Report Resource Website |
RRID:Addgene_119124 | p47phox-PX (1-122) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCGTLMSLPTKISRCPHLLDFFKVRP | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:02 | 0 | |
|
SNX8-PX (70-190) Resource Report Resource Website |
RRID:Addgene_119089 | SNX8-PX (70-190) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: ELLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGADREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGSDVQNKLKESA | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:01 | 0 | |
|
SNX17-PX (1-111) Resource Report Resource Website |
RRID:Addgene_119098 | SNX17-PX (1-111) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFPPKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQ | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:03 | 0 | |
|
SNX15-PX (1-127) Resource Report Resource Website |
RRID:Addgene_119096 | SNX15-PX (1-127) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: MSRQAKDDFLRHYTVSDPRTHPKGYTEYKVTAQFISKKDPEDVKEVVVWKRYSDFRKLHGDLAYTHRNLFRRLEEFPAFPRAQVFGRFEASVIEERRKGAEDLLRFTVHIPALNNSPQLKEFFRGG | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:01 | 0 | |
|
SNX11-PX (7-167) Resource Report Resource Website |
RRID:Addgene_119092 | SNX11-PX (7-167) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: MSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQ | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:03 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.