Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Organism:homo sapiens (facet)


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

69,655 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
SGK3-PX (1-126)
 
Resource Report
Resource Website
RRID:Addgene_119117 SGK3-PX (1-126) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQS Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:03 0
SH3PXD2A-PX (1-126)
 
Resource Report
Resource Website
RRID:Addgene_119115 SH3PXD2A-PX (1-126) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: MLAYCVQDATVVDVEKRRNPSKHYVYIINVTWSDSTSQTIYRRYSKFFDLQMQLLDKFPIEGGQKDPKQRIIPFLPGKILFRRSHIRDVAVKRLKPIDEYCRALVRLPPHISQCDEVFRFFEARP Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:02 0
SNX34-PX (1-130)
 
Resource Report
Resource Website
RRID:Addgene_119113 SNX34-PX (1-130) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: MASAVFEGTSLVNMFVRGCWVNGIRRLIVSRRGDEEEFFEIRTEWSDRSVLYLHRSLADLGRLWQRLRDAFPEDRSELAQGPLRQGLVAIKEAHDIETRLNEVEKLLKTIISMPCKYSRSEVVLTFFERS Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:03 0
PXK-PX (1-125)
 
Resource Report
Resource Website
RRID:Addgene_119114 PXK-PX (1-125) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYS Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:02 0
mCherry-PIS
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_119078 PIS Homo sapiens Kanamycin PMID:23263280 Backbone Marker:Clonetech; Backbone Size:4700; Vector Backbone:mCherry-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-08-29 12:53:01 1
SNX32-PX (17-166)
 
Resource Report
Resource Website
RRID:Addgene_119111 SNX32-PX (17-166) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: SVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQD Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:02 0
SNX6-PX (27-171)
 
Resource Report
Resource Website
RRID:Addgene_119087 SNX6-PX (29-170) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: QSDAALQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRRDLNFHVFLEYNQ Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:03 0
PI3KC2beta-PX (1348-1487)
 
Resource Report
Resource Website
RRID:Addgene_119120 PI3KC2beta-PX (1348-1487) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: DRLTLSFASRTHTLKSSGRISDVFLCRHEKIFHPNKGYIYVVKVMRENTHEATYIQRTFEEFQELHNKLRLLFPSSHLPSFPSRFVIGRSRGEAVAERRREELNGYIWHLIHAPPEVAECDLVYTFFHPLPRDEKAMGTS Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:02 0
PI3KC2gamma-PX (1200-1310)
 
Resource Report
Resource Website
RRID:Addgene_119121 PI3KC2gamma-PX (1200-1310) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: STTRSIERATILGFSKKSSNLYLIQVTHSNNETSLTEKSFEQFSKLHSQLQKQFASLTLPEFPHWWHLPFTNSDHRRFRDLNHYMEQILNVSHEVTNSDCVLSFFLSEAVQ Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:02 0
SNX27-PX (156-265)
 
Resource Report
Resource Website
RRID:Addgene_119106 SNX27-PX (156-265) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: DYTEKQAVPISVPRYKHVEQNGEKFVVYNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEEYLEKVCSIRVIGESDIMQEFLSES Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:02 0
SNX28-PX (1-124)
 
Resource Report
Resource Website
RRID:Addgene_119107 SNX28-PX (1-124) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKTLKETFPVEAGLLRRSDRVLPKLLDAPLLGRVGRTSRGLARLQLLETYSRRLLATAERVARSPTITGFFAPQPLD Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:03 0
SNX25-PX (506-628)
 
Resource Report
Resource Website
RRID:Addgene_119104 SNX25-PX (506-628) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: NLGMWKASITSGEVTEENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQNLLSDERLCQSEALYAFLSPSPDYL Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:03 0
SNX26-PX (56-172)
 
Resource Report
Resource Website
RRID:Addgene_119105 SNX26-PX (56-172) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: NVDFGHIQLLLSPDREGPSLSGENELVFGVQVTCQGRSWPVLRSYDDFRSLDAHLHRCIFDRRFSCLPELPPPPEGARAAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMELDNHG Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:02 0
SNX23-PX (1178-1312)
 
Resource Report
Resource Website
RRID:Addgene_119102 SNX23-PX (1178-1312) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: DLKDPIKISIPRYVLCGQGKDAHFEFEVKITVLDETWTVFRRYSRFREMHKTLKLKYAELAALEFPPKKLFGNKDERVIAERRSHLEKYLRDFFSVMLQSATSPLHINKVGLTLSKHTICEFSPFFKKGVFDYS Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-29 12:53:02 0
pET28-His-TEV-NQO1
 
Resource Report
Resource Website
RRID:Addgene_119058 NAD(P)H dehydrogenase, quinone 1 (NQO1) Homo sapiens Kanamycin PMID:15809436 Backbone Marker:Novagen; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-29 12:53:03 0
FUW-TIE1-Cherry
 
Resource Report
Resource Website
RRID:Addgene_119236 TIE1-mCherry Homo sapiens Ampicillin Vector Backbone:FUW; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin 2026-08-29 12:53:04 0
FUW-hTie1-ECD-FLAG
 
Resource Report
Resource Website
RRID:Addgene_119235 TIE1-ECD-FLAG Homo sapiens Ampicillin Vector Backbone:FUW; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin Contains extracellular domain (ECD) only 2026-08-29 12:53:03 0
Desmoplakin I donor only control (F40-based tension sensor)
 
Resource Report
Resource Website
RRID:Addgene_119188 human Desmoplakin I-[mTFP1-F40-mEYFP(Y67G)] (internal-1945) Homo sapiens Ampicillin PMID:30538252 Backbone Marker:Eric Kowarz; Backbone Size:5569; Vector Backbone:pSBtet-Pur; Vector Types:Mammalian Expression, Transposon; Bacterial Resistance:Ampicillin inserted F40-based tension sensor module after aa1945; Y67G in mEYFP to disrupt chromophore formation 2026-08-29 12:53:02 0
Desmoplakin I acceptor only control (F40-based tension sensor)
 
Resource Report
Resource Website
RRID:Addgene_119189 human Desmoplakin I-[mTFP1(Y72G)-F40-mEYFP] (internal-1945) Homo sapiens Ampicillin PMID:30538252 Backbone Marker:Eric Kowarz; Backbone Size:5569; Vector Backbone:pSBtet-Pur; Vector Types:Mammalian Expression, Transposon; Bacterial Resistance:Ampicillin inserted F40-based tension sensor module after aa1945; Y72G in mTFP1 to disrupt chromophore formation 2026-08-29 12:53:04 0
Desmoplakin I affinity mutant (F40-based tension sensor)
 
Resource Report
Resource Website
RRID:Addgene_119190 human Desmoplakin I(S2849G)-[mTFP1-F40-mEYFP] (internal-1945) Homo sapiens Ampicillin PMID:30538252 Backbone Marker:Eric Kowarz; Backbone Size:5569; Vector Backbone:pSBtet-Pur; Vector Types:Mammalian Expression, Transposon; Bacterial Resistance:Ampicillin inserted F40-based tension sensor module after aa1945; S2849G in DPI which exhibits increased keratin association 2026-08-29 12:53:02 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.