Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
SGK3-PX (1-126) Resource Report Resource Website |
RRID:Addgene_119117 | SGK3-PX (1-126) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQS | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:03 | 0 | |
|
SH3PXD2A-PX (1-126) Resource Report Resource Website |
RRID:Addgene_119115 | SH3PXD2A-PX (1-126) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: MLAYCVQDATVVDVEKRRNPSKHYVYIINVTWSDSTSQTIYRRYSKFFDLQMQLLDKFPIEGGQKDPKQRIIPFLPGKILFRRSHIRDVAVKRLKPIDEYCRALVRLPPHISQCDEVFRFFEARP | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:02 | 0 | |
|
SNX34-PX (1-130) Resource Report Resource Website |
RRID:Addgene_119113 | SNX34-PX (1-130) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: MASAVFEGTSLVNMFVRGCWVNGIRRLIVSRRGDEEEFFEIRTEWSDRSVLYLHRSLADLGRLWQRLRDAFPEDRSELAQGPLRQGLVAIKEAHDIETRLNEVEKLLKTIISMPCKYSRSEVVLTFFERS | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:03 | 0 | |
|
PXK-PX (1-125) Resource Report Resource Website |
RRID:Addgene_119114 | PXK-PX (1-125) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYS | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:02 | 0 | |
|
mCherry-PIS Resource Report Resource Website 1+ mentions |
RRID:Addgene_119078 | PIS | Homo sapiens | Kanamycin | PMID:23263280 | Backbone Marker:Clonetech; Backbone Size:4700; Vector Backbone:mCherry-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-29 12:53:01 | 1 | ||
|
SNX32-PX (17-166) Resource Report Resource Website |
RRID:Addgene_119111 | SNX32-PX (17-166) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: SVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQD | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:02 | 0 | |
|
SNX6-PX (27-171) Resource Report Resource Website |
RRID:Addgene_119087 | SNX6-PX (29-170) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: QSDAALQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRRDLNFHVFLEYNQ | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:03 | 0 | |
|
PI3KC2beta-PX (1348-1487) Resource Report Resource Website |
RRID:Addgene_119120 | PI3KC2beta-PX (1348-1487) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: DRLTLSFASRTHTLKSSGRISDVFLCRHEKIFHPNKGYIYVVKVMRENTHEATYIQRTFEEFQELHNKLRLLFPSSHLPSFPSRFVIGRSRGEAVAERRREELNGYIWHLIHAPPEVAECDLVYTFFHPLPRDEKAMGTS | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:02 | 0 | |
|
PI3KC2gamma-PX (1200-1310) Resource Report Resource Website |
RRID:Addgene_119121 | PI3KC2gamma-PX (1200-1310) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: STTRSIERATILGFSKKSSNLYLIQVTHSNNETSLTEKSFEQFSKLHSQLQKQFASLTLPEFPHWWHLPFTNSDHRRFRDLNHYMEQILNVSHEVTNSDCVLSFFLSEAVQ | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:02 | 0 | |
|
SNX27-PX (156-265) Resource Report Resource Website |
RRID:Addgene_119106 | SNX27-PX (156-265) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: DYTEKQAVPISVPRYKHVEQNGEKFVVYNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEEYLEKVCSIRVIGESDIMQEFLSES | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:02 | 0 | |
|
SNX28-PX (1-124) Resource Report Resource Website |
RRID:Addgene_119107 | SNX28-PX (1-124) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKTLKETFPVEAGLLRRSDRVLPKLLDAPLLGRVGRTSRGLARLQLLETYSRRLLATAERVARSPTITGFFAPQPLD | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:03 | 0 | |
|
SNX25-PX (506-628) Resource Report Resource Website |
RRID:Addgene_119104 | SNX25-PX (506-628) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: NLGMWKASITSGEVTEENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQNLLSDERLCQSEALYAFLSPSPDYL | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:03 | 0 | |
|
SNX26-PX (56-172) Resource Report Resource Website |
RRID:Addgene_119105 | SNX26-PX (56-172) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: NVDFGHIQLLLSPDREGPSLSGENELVFGVQVTCQGRSWPVLRSYDDFRSLDAHLHRCIFDRRFSCLPELPPPPEGARAAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMELDNHG | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:02 | 0 | |
|
SNX23-PX (1178-1312) Resource Report Resource Website |
RRID:Addgene_119102 | SNX23-PX (1178-1312) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: DLKDPIKISIPRYVLCGQGKDAHFEFEVKITVLDETWTVFRRYSRFREMHKTLKLKYAELAALEFPPKKLFGNKDERVIAERRSHLEKYLRDFFSVMLQSATSPLHINKVGLTLSKHTICEFSPFFKKGVFDYS | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:02 | 0 | |
|
pET28-His-TEV-NQO1 Resource Report Resource Website |
RRID:Addgene_119058 | NAD(P)H dehydrogenase, quinone 1 (NQO1) | Homo sapiens | Kanamycin | PMID:15809436 | Backbone Marker:Novagen; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-29 12:53:03 | 0 | ||
|
FUW-TIE1-Cherry Resource Report Resource Website |
RRID:Addgene_119236 | TIE1-mCherry | Homo sapiens | Ampicillin | Vector Backbone:FUW; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-29 12:53:04 | 0 | |||
|
FUW-hTie1-ECD-FLAG Resource Report Resource Website |
RRID:Addgene_119235 | TIE1-ECD-FLAG | Homo sapiens | Ampicillin | Vector Backbone:FUW; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin | Contains extracellular domain (ECD) only | 2026-08-29 12:53:03 | 0 | ||
|
Desmoplakin I donor only control (F40-based tension sensor) Resource Report Resource Website |
RRID:Addgene_119188 | human Desmoplakin I-[mTFP1-F40-mEYFP(Y67G)] (internal-1945) | Homo sapiens | Ampicillin | PMID:30538252 | Backbone Marker:Eric Kowarz; Backbone Size:5569; Vector Backbone:pSBtet-Pur; Vector Types:Mammalian Expression, Transposon; Bacterial Resistance:Ampicillin | inserted F40-based tension sensor module after aa1945; Y67G in mEYFP to disrupt chromophore formation | 2026-08-29 12:53:02 | 0 | |
|
Desmoplakin I acceptor only control (F40-based tension sensor) Resource Report Resource Website |
RRID:Addgene_119189 | human Desmoplakin I-[mTFP1(Y72G)-F40-mEYFP] (internal-1945) | Homo sapiens | Ampicillin | PMID:30538252 | Backbone Marker:Eric Kowarz; Backbone Size:5569; Vector Backbone:pSBtet-Pur; Vector Types:Mammalian Expression, Transposon; Bacterial Resistance:Ampicillin | inserted F40-based tension sensor module after aa1945; Y72G in mTFP1 to disrupt chromophore formation | 2026-08-29 12:53:04 | 0 | |
|
Desmoplakin I affinity mutant (F40-based tension sensor) Resource Report Resource Website |
RRID:Addgene_119190 | human Desmoplakin I(S2849G)-[mTFP1-F40-mEYFP] (internal-1945) | Homo sapiens | Ampicillin | PMID:30538252 | Backbone Marker:Eric Kowarz; Backbone Size:5569; Vector Backbone:pSBtet-Pur; Vector Types:Mammalian Expression, Transposon; Bacterial Resistance:Ampicillin | inserted F40-based tension sensor module after aa1945; S2849G in DPI which exhibits increased keratin association | 2026-08-29 12:53:02 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.