Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Mus musculus
Genetic Insert: Megf10
Vector Backbone Description: Vector Backbone:pUb-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:22407321
Proper citation: RRID:Addgene_40207 Copy
Species: Virus
Genetic Insert: MCPyV sT codon optimized
Vector Backbone Description: Backbone Marker:Invirtogen; Backbone Size:4985; Vector Backbone:pcDNA6.V5.HisB; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:21841310
Proper citation: RRID:Addgene_40201 Copy
Vector Backbone Description: Backbone Marker:CLONTECH; Backbone Size:4814; Vector Backbone:pDIRECT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24747757
Comments: For more information on Pelczar TALEN Add-On Plasmids please refer to: http://www.addgene.org/TALeffector/goldengate/add-ons/#pelczar
Please note that plasmid #40132 is only functional in combination with plasmid #40131.
Proper citation: RRID:Addgene_40132 Copy
Species: E. coli
Genetic Insert: gusA
Vector Backbone Description: Vector Backbone:RP4; Vector Types:Bacterial Expression; Bacterial Resistance:Tetracycline
Defining Citation: PMID:22820336
Comments: GenBank accession number JQ895026
Multiple-cloning site (MCS) of pLMB51: GATTACCTCA GTCTAGAGCT CGAGAAGCTT GGATCCATGG TACCCTACA
Proper citation: RRID:Addgene_40083 Copy
Species: Synthetic
Genetic Insert: LOV-ipaA
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5442; Vector Backbone:pET-21b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:22520757
Comments: This vector encodes a photo-activable caged form of the vinculin binding ipaA peptide.
Regarding the hybridized region, the first ten residues of the ipaA VBS1 helical peptide were identified as a close match to the last ten residues of the AsLOV2 Jα helix; five of the ten positions are identical, and the hydrophobic residues on the Jα helix that make critical contacts with the AsLOV2 domain beta-sheet at residues 539, 542, and 543 are conserved in the alignment with ipaA. Additionally, residues in the ipaA sequence that make extensive contacts with vinculin are conserved in the alignment (Ile 612, Ala 615, Ala 616, and Val 619 in ipaA). Side-chain optimization simulations were used to thread the first ten residues of ipaA onto the last ten residues of the Jα helix. The 540 position on the Jα helix was converted to isoleucine.
The LOV-ipaA gene was synthesized with a six histidine N-terminal tag (Genscript, Piscataway, NJ, USA) and cloned into the pET21b vector.
Protein coding sequence of LOV-ipaA:
MHHHHHHGSLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTANNIIKAAKDVTTSLSKVLKNIN
Proper citation: RRID:Addgene_40236 Copy
Genetic Insert: yEGFP1
Vector Backbone Description: Backbone Size:5667; Vector Backbone:pRS413; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: yEGFP contains a M233I point mutation. Depositor states that this mutation does not affect yEGFP function.
Proper citation: RRID:Addgene_40235 Copy
Species: Mus musculus
Genetic Insert: CD40L
Vector Backbone Description: Backbone Marker:Addgene plasmid 40569; Vector Backbone:MIEG-hCD4; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:19405121
Comments: The CD40-ligand (CD40L)-expressing retroviral vector was constructed by PCR amplification of cDNA from anti-CD3 activated mouse T cells with the following primers for CD40-ligand: sense 5'-CTTTCAGTCAGCATGATAGAAACA-3' and antisense
5'-TCAGAGTTTGAGTAAGCCAAAAGA-3'; these primers were used to amplify the complete coding region of mouse CD40 ligand. The CD40-ligand gene was then reamplified with primers containing XhoI and NotI sites and then cloned via XhoI and NotI sites into a retroviral vector expressing human CD4.
Proper citation: RRID:Addgene_40355 Copy
Species: Homo sapiens
Genetic Insert: Jun dominant negative
Vector Backbone Description: Backbone Marker:David A. Williams (PMID: 10961859); Vector Backbone:pMIEG3; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15699140
Comments: The Jun dominant negative vector was made by first preparing a version of c-Jun with the first 122 aa deleted. This cDNA was amplified by PCR from human c-Jun with the following primers:
sense, 5-AAAAAA-GAATTC-ATGACTAGCCAGAACACGCTGCCCAGCGTC-3;
antisense, 5-AAAAAA-GAATTC-TCAGCTGGCATAGTCAGGCACGTCATAAGGATAGCTAAATGTTTGCAAC-3.
The antisense primer adds a hemagglutinin tag to the C terminus of c-Jun. The PCR product was then cut with EcoRI and cloned into the retroviral vector pMIEG3.
Proper citation: RRID:Addgene_40350 Copy
Species: Homo sapiens
Genetic Insert: BCL6
Vector Backbone Description: Backbone Marker:Niwa, Yamamura, and Miyazaki (PMID: 1660837); Backbone Size:5200; Vector Backbone:pCXN2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12165517
Comments: CXN-BCL-6 was constructed by inserting the human BCL-6 cDNA from pBS-BCL-6 full length (FL) via SalI ends into the XhoI site in the pCXN2 expression vector. The pCXN2 (CXN) vector was obtained from Dr. K. Ozato (National Institute of Child Health and Human Development, National Institutes of Health, Bethesda, MD) and consists of the human BCL-6 cDNA driven by a hybrid β-actin-CMV promoter.
Proper citation: RRID:Addgene_40346 Copy
Species: Rous sarcoma virus (RSV)
Genetic Insert: RSV promoter
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-basic; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12165517
Comments: The Rous sarcoma virus (RSV) promoter reporter was constructed by isolating the RSV promoter from pRc/RSV (Invitrogen) via BglII and HindIII sites and cloned into pGL3-basic by the same sites.
Proper citation: RRID:Addgene_40343 Copy
Genetic Insert: 3xAP-1
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-basic; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12165517
Comments: The 3 AP-1 reporter contains three canonical AP-1 binding sites (TGACTCA) upstream of a minimal promoter fragment containing a TATA box in the luciferase reporter plasmid pGL3-basic.
Proper citation: RRID:Addgene_40342 Copy
Species: Homo sapiens
Genetic Insert: Pumilio homolog 2
Vector Backbone Description: Backbone Size:5372; Vector Backbone:pFRT/FLAG/HA-DEST; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:20371350
Comments: Note that there are some cloning scars flanking the insert (see Addgene sequence), but they will not affect plasmid function.
Proper citation: RRID:Addgene_40292 Copy
Species: Homo sapiens
Genetic Insert: Calnexin
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23656278
Comments: Addgene sequencing results find I474N in calnexin translation compared to reference sequence NP_001737.1
Proper citation: RRID:Addgene_40290 Copy
Species: Mus musculus
Genetic Insert: 2C Promoter (2-cell stage promoter)
Vector Backbone Description: Backbone Marker:Invitrogen/Life Tech; Backbone Size:6400; Vector Backbone:pcDNA Hygro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:22722858
Comments: The CMV promoter from the parent pcDNA plasmid was removed with MluI and HindIII, leaving approx. 6400kb backbone. The 2C promoter was put in its place (730bp) using the same sites. Hence, the full plasmid is 7129bp. The promoter is active shortly after fertilization of mouse embryos to about the 8-cell stage. It is also on in a subset of MESCs & miPSCs.
Proper citation: RRID:Addgene_40281 Copy
Vector Backbone Description: Backbone Size:6447; Vector Backbone:JDS94; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: Backbone contains NNN/G 0.5 Domain
TAL N-terminal: ∆152 (Miller et al. 2011)
TAL C-terminus: +63 (Miller et al. 2011)
FOKI: ELD (-) heterodimer (Doyon et al. 2011)
Proper citation: RRID:Addgene_40322 Copy
Vector Backbone Description: Backbone Size:6447; Vector Backbone:JDS92; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: Backbone contains SHD/C 0.5 Domain
TAL N-terminal: ∆152 (Miller et al. 2011)
TAL C-terminus: +63 (Miller et al. 2011)
FOKI: ELD (-) heterodimer (Doyon et al. 2011)
Proper citation: RRID:Addgene_40321 Copy
Species: Synthetic
Genetic Insert: ddGFP-B
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:4100; Vector Backbone:pBad-modified; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23656278
Proper citation: RRID:Addgene_40287 Copy
Vector Backbone Description: Backbone Size:6447; Vector Backbone:JDS90; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: Backbone contains SNI/A 0.5 Domain
TAL N-terminal: ∆152 (Miller et al. 2011)
TAL C-terminus: +63 (Miller et al. 2011)
FOKI: ELD (-) heterodimer (Doyon et al. 2011)
Proper citation: RRID:Addgene_40320 Copy
Genetic Insert: NaChBac
Vector Backbone Description: Backbone Size:8914; Vector Backbone:pUAST; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16407556
Proper citation: RRID:Addgene_40283 Copy
Vector Backbone Description: Backbone Size:6447; Vector Backbone:JDS88; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: Backbone contains SNG/T 0.5 Domain
TAL N-terminal: ∆152 (Miller et al. 2011)
TAL C-terminus: +63 (Miller et al. 2011)
FOKI: KKR (+) heterodimer (Doyon et al. 2011)
Proper citation: RRID:Addgene_40319 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
