Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
Ubc-megf10-GFP Resource Report Resource Website 1+ mentions |
RRID:Addgene_40207 | Megf10 | Mus musculus | Ampicillin | PMID:22407321 | Vector Backbone:pUb-GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:34 | 2 | ||
|
pcDNA6 MCV sTco Resource Report Resource Website 1+ mentions |
RRID:Addgene_40201 | MCPyV sT codon optimized | Virus | Ampicillin | PMID:21841310 | Backbone Marker:Invirtogen; Backbone Size:4985; Vector Backbone:pcDNA6.V5.HisB; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:34 | 5 | ||
|
pCAG-T7-TALEN(Sangamo)-FokI-ELD-Destination Resource Report Resource Website 1+ mentions |
RRID:Addgene_40132 | Ampicillin | PMID:24747757 | For more information on Pelczar TALEN Add-On Plasmids please refer to: http://www.addgene.org/TALeffector/goldengate/add-ons/#pelczar Please note that plasmid #40132 is only functional in combination with plasmid #40131. | Backbone Marker:CLONTECH; Backbone Size:4814; Vector Backbone:pDIRECT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:33 | 1 | |||
|
pLMB51 Resource Report Resource Website 1+ mentions |
RRID:Addgene_40083 | gusA | E. coli | Tetracycline | PMID:22820336 | GenBank accession number JQ895026 Multiple-cloning site (MCS) of pLMB51: GATTACCTCA GTCTAGAGCT CGAGAAGCTT GGATCCATGG TACCCTACA | Vector Backbone:RP4; Vector Types:Bacterial Expression; Bacterial Resistance:Tetracycline | 2026-08-15 01:14:33 | 1 | |
|
pET21b-LOV-ipaA Resource Report Resource Website 1+ mentions |
RRID:Addgene_40236 | LOV-ipaA | Synthetic | Ampicillin | PMID:22520757 | This vector encodes a photo-activable caged form of the vinculin binding ipaA peptide. Regarding the hybridized region, the first ten residues of the ipaA VBS1 helical peptide were identified as a close match to the last ten residues of the AsLOV2 Jα helix; five of the ten positions are identical, and the hydrophobic residues on the Jα helix that make critical contacts with the AsLOV2 domain beta-sheet at residues 539, 542, and 543 are conserved in the alignment with ipaA. Additionally, residues in the ipaA sequence that make extensive contacts with vinculin are conserved in the alignment (Ile 612, Ala 615, Ala 616, and Val 619 in ipaA). Side-chain optimization simulations were used to thread the first ten residues of ipaA onto the last ten residues of the Jα helix. The 540 position on the Jα helix was converted to isoleucine. The LOV-ipaA gene was synthesized with a six histidine N-terminal tag (Genscript, Piscataway, NJ, USA) and cloned into the pET21b vector. Protein coding sequence of LOV-ipaA: MHHHHHHGSLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTANNIIKAAKDVTTSLSKVLKNIN | Backbone Marker:EMD Biosciences; Backbone Size:5442; Vector Backbone:pET-21b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | Jα helix region hybridized (AsLOV2 aa 537-546/ipaA aa 610-619), residue 540 changed to isoleucine | 2026-08-15 01:14:34 | 1 |
|
pRS413-GAL1-yEGFP1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_40235 | yEGFP1 | Ampicillin | yEGFP contains a M233I point mutation. Depositor states that this mutation does not affect yEGFP function. | Backbone Size:5667; Vector Backbone:pRS413; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:34 | 3 | |||
|
CD40L-MIEG-hCD4 (hCD4-CD40L) Resource Report Resource Website 1+ mentions |
RRID:Addgene_40355 | CD40L | Mus musculus | Ampicillin | PMID:19405121 | The CD40-ligand (CD40L)-expressing retroviral vector was constructed by PCR amplification of cDNA from anti-CD3 activated mouse T cells with the following primers for CD40-ligand: sense 5'-CTTTCAGTCAGCATGATAGAAACA-3' and antisense 5'-TCAGAGTTTGAGTAAGCCAAAAGA-3'; these primers were used to amplify the complete coding region of mouse CD40 ligand. The CD40-ligand gene was then reamplified with primers containing XhoI and NotI sites and then cloned via XhoI and NotI sites into a retroviral vector expressing human CD4. | Backbone Marker:Addgene plasmid 40569; Vector Backbone:MIEG-hCD4; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 2 | |
|
pMIEG3-JunDN Resource Report Resource Website 1+ mentions |
RRID:Addgene_40350 | Jun dominant negative | Homo sapiens | Ampicillin | PMID:15699140 | The Jun dominant negative vector was made by first preparing a version of c-Jun with the first 122 aa deleted. This cDNA was amplified by PCR from human c-Jun with the following primers: sense, 5-AAAAAA-GAATTC-ATGACTAGCCAGAACACGCTGCCCAGCGTC-3; antisense, 5-AAAAAA-GAATTC-TCAGCTGGCATAGTCAGGCACGTCATAAGGATAGCTAAATGTTTGCAAC-3. The antisense primer adds a hemagglutinin tag to the C terminus of c-Jun. The PCR product was then cut with EcoRI and cloned into the retroviral vector pMIEG3. | Backbone Marker:David A. Williams (PMID: 10961859); Vector Backbone:pMIEG3; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | first 122 amino acids deleted | 2026-08-15 01:14:35 | 7 |
|
pCXN2-BCL6 (CXN-BCL6) Resource Report Resource Website 1+ mentions |
RRID:Addgene_40346 | BCL6 | Homo sapiens | Ampicillin | PMID:12165517 | CXN-BCL-6 was constructed by inserting the human BCL-6 cDNA from pBS-BCL-6 full length (FL) via SalI ends into the XhoI site in the pCXN2 expression vector. The pCXN2 (CXN) vector was obtained from Dr. K. Ozato (National Institute of Child Health and Human Development, National Institutes of Health, Bethesda, MD) and consists of the human BCL-6 cDNA driven by a hybrid β-actin-CMV promoter. | Backbone Marker:Niwa, Yamamura, and Miyazaki (PMID: 1660837); Backbone Size:5200; Vector Backbone:pCXN2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 3 | |
|
RSVpGL3 (RSV promoter-luciferase in pGL3-basic) Resource Report Resource Website 1+ mentions |
RRID:Addgene_40343 | RSV promoter | Rous sarcoma virus (RSV) | Ampicillin | PMID:12165517 | The Rous sarcoma virus (RSV) promoter reporter was constructed by isolating the RSV promoter from pRc/RSV (Invitrogen) via BglII and HindIII sites and cloned into pGL3-basic by the same sites. | Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-basic; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 2 | |
|
3xAP1pGL3 (3xAP-1 in pGL3-basic) Resource Report Resource Website 50+ mentions |
RRID:Addgene_40342 | 3xAP-1 | Ampicillin | PMID:12165517 | The 3 AP-1 reporter contains three canonical AP-1 binding sites (TGACTCA) upstream of a minimal promoter fragment containing a TATA box in the luciferase reporter plasmid pGL3-basic. | Backbone Marker:Promega; Backbone Size:4818; Vector Backbone:pGL3-basic; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin | Contains three canonical AP-1 binding sites (TGACTCA) upstream of a minimal promoter fragment containing a TATA box | 2026-08-15 01:14:35 | 54 | |
|
pFRT/FLAG/HA-DEST PUM2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_40292 | Pumilio homolog 2 | Homo sapiens | Ampicillin | PMID:20371350 | Note that there are some cloning scars flanking the insert (see Addgene sequence), but they will not affect plasmid function. | Backbone Size:5372; Vector Backbone:pFRT/FLAG/HA-DEST; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 1 | |
|
pCalN-ddGFP-A Resource Report Resource Website 1+ mentions |
RRID:Addgene_40290 | Calnexin | Homo sapiens | Ampicillin | PMID:23656278 | Addgene sequencing results find I474N in calnexin translation compared to reference sequence NP_001737.1 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 1 | |
|
2C::tdTomato Reporter Resource Report Resource Website 10+ mentions |
RRID:Addgene_40281 | 2C Promoter (2-cell stage promoter) | Mus musculus | Ampicillin | PMID:22722858 | The CMV promoter from the parent pcDNA plasmid was removed with MluI and HindIII, leaving approx. 6400kb backbone. The 2C promoter was put in its place (730bp) using the same sites. Hence, the full plasmid is 7129bp. The promoter is active shortly after fertilization of mouse embryos to about the 8-cell stage. It is also on in a subset of MESCs & miPSCs. | Backbone Marker:Invitrogen/Life Tech; Backbone Size:6400; Vector Backbone:pcDNA Hygro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 15 | |
|
JDS94 Resource Report Resource Website 1+ mentions |
RRID:Addgene_40322 | Ampicillin | Backbone contains NNN/G 0.5 Domain TAL N-terminal: ∆152 (Miller et al. 2011) TAL C-terminus: +63 (Miller et al. 2011) FOKI: ELD (-) heterodimer (Doyon et al. 2011) | Backbone Size:6447; Vector Backbone:JDS94; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 1 | ||||
|
JDS92 Resource Report Resource Website 1+ mentions |
RRID:Addgene_40321 | Ampicillin | Backbone contains SHD/C 0.5 Domain TAL N-terminal: ∆152 (Miller et al. 2011) TAL C-terminus: +63 (Miller et al. 2011) FOKI: ELD (-) heterodimer (Doyon et al. 2011) | Backbone Size:6447; Vector Backbone:JDS92; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 1 | ||||
|
pDDGFP-B Resource Report Resource Website 1+ mentions |
RRID:Addgene_40287 | ddGFP-B | Synthetic | Ampicillin | PMID:23656278 | Backbone Marker:Invitrogen; Backbone Size:4100; Vector Backbone:pBad-modified; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 2 | ||
|
JDS90 Resource Report Resource Website 1+ mentions |
RRID:Addgene_40320 | Ampicillin | Backbone contains SNI/A 0.5 Domain TAL N-terminal: ∆152 (Miller et al. 2011) TAL C-terminus: +63 (Miller et al. 2011) FOKI: ELD (-) heterodimer (Doyon et al. 2011) | Backbone Size:6447; Vector Backbone:JDS90; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 1 | ||||
|
pUAST-NaChBac Resource Report Resource Website 1+ mentions |
RRID:Addgene_40283 | NaChBac | Ampicillin | PMID:16407556 | Backbone Size:8914; Vector Backbone:pUAST; Vector Types:; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 1 | |||
|
JDS88 Resource Report Resource Website 1+ mentions |
RRID:Addgene_40319 | Ampicillin | Backbone contains SNG/T 0.5 Domain TAL N-terminal: ∆152 (Miller et al. 2011) TAL C-terminus: +63 (Miller et al. 2011) FOKI: KKR (+) heterodimer (Doyon et al. 2011) | Backbone Size:6447; Vector Backbone:JDS88; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:14:35 | 1 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
