Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Mus musculus
Genetic Insert: Kir2.1
Vector Backbone Description: Backbone Marker:James Bamburg lab; Backbone Size:9057; Vector Backbone:RedTrackCMV; Vector Types:Mammalian Expression, Adenoviral; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30482691
Proper citation: RRID:Addgene_117856 Copy
Species: Synthetic
Genetic Insert: promoter, RBS, scOrange
Vector Backbone Description: Backbone Marker:iGEM Registry; Vector Backbone:BioBrick pSB1C3 vector; Vector Types:Synthetic Biology, Escherichia coli; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:29760772
Proper citation: RRID:Addgene_117840 Copy
Species: Synthetic
Genetic Insert: promoter, RBS, tsPurple
Vector Backbone Description: Backbone Marker:iGEM Registry; Vector Backbone:BioBrick pSB1C3 vector; Vector Types:Synthetic Biology, Escherichia coli; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:29760772
Proper citation: RRID:Addgene_117848 Copy
Species: Synthetic
Genetic Insert: promoter, RBS, amajLime
Vector Backbone Description: Backbone Marker:iGEM Registry; Vector Backbone:BioBrick pSB1C3 vector; Vector Types:Synthetic Biology, Escherichia coli; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:29760772
Proper citation: RRID:Addgene_117843 Copy
Species: Synthetic
Genetic Insert: promoter, RBS, aeBlue
Vector Backbone Description: Backbone Marker:iGEM Registry; Vector Backbone:BioBrick pSB1C3 vector; Vector Types:Synthetic Biology, Escherichia coli; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:29760772
Proper citation: RRID:Addgene_117846 Copy
Vector Backbone Description: Backbone Size:4193; Vector Backbone:pMEG_BB3_YL68N_AD; Vector Types:Bacterial Expression, Yeast Expression; Bacterial Resistance:Nourseothricin (clonNat)
Defining Citation: PMID:30698703
Comments: Contains 34 bp GoldenMOCS-Yali Linker AB
Proper citation: RRID:Addgene_117831 Copy
Vector Backbone Description: Backbone Size:4193; Vector Backbone:pMEG_BB3_YL68N_AC; Vector Types:Bacterial Expression, Yeast Expression; Bacterial Resistance:Nourseothricin (clonNat)
Defining Citation: PMID:30698703
Comments: Contains 34 bp GoldenMOCS-Yali Linker AB
Proper citation: RRID:Addgene_117830 Copy
Species: Synthetic
Genetic Insert: promoter, RBS, eforRed
Vector Backbone Description: Backbone Marker:iGEM Registry; Vector Backbone:BioBrick pSB1C3 vector; Vector Types:Synthetic Biology, Escherichia coli; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:29760772
Proper citation: RRID:Addgene_117837 Copy
Species: Synthetic
Genetic Insert: promoter, RBS, meffRed
Vector Backbone Description: Backbone Marker:iGEM Registry; Vector Backbone:BioBrick pSB1C3 vector; Vector Types:Synthetic Biology, Escherichia coli; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:29760772
Proper citation: RRID:Addgene_117836 Copy
Species: Synthetic
Genetic Insert: promoter, RBS, asPink
Vector Backbone Description: Backbone Marker:iGEM Registry; Vector Backbone:BioBrick pSB1C3 vector; Vector Types:Synthetic Biology, Escherichia coli; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:29760772
Proper citation: RRID:Addgene_117838 Copy
Species: Other
Genetic Insert: YlpGPD
Vector Backbone Description: Backbone Size:2028; Vector Backbone:pIDTSMART-KAN; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30698703
Proper citation: RRID:Addgene_117820 Copy
Species: Other
Genetic Insert: YlpTEF_YlGUT1_YlCyc1TT
Vector Backbone Description: Backbone Size:4193; Vector Backbone:pMEG_BB3_YL68N_AB; Vector Types:Bacterial Expression, Yeast Expression; Bacterial Resistance:Nourseothricin (clonNat)
Defining Citation: PMID:30698703
Proper citation: RRID:Addgene_117825 Copy
Vector Backbone Description: Backbone Size:4649; Vector Backbone:pMEG_BB3_YL18H_AC; Vector Types:Bacterial Expression, Yeast Expression; Bacterial Resistance:Hygromycin
Defining Citation: PMID:30698703
Comments: Contains 34 bp GoldenMOCS-Yali Linker AB
Proper citation: RRID:Addgene_117828 Copy
Species: Other
Genetic Insert: YlGUT1
Vector Backbone Description: Backbone Size:1966; Vector Backbone:BB1_L_23_syn_BsaI; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30698703
Proper citation: RRID:Addgene_117823 Copy
Species: Oryza sativa
Genetic Insert: OsPQL upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MGIFSGAGAHRPSCPSAANCAKWAQTYLKYCLCSTRDGMALTLGLLSVISWGVAEVPQIITNYKHKSTEGLSLAFLMTWIVGDFFNLIGCFLEPETLPTQFYMALLYTITTVILTGQTVYYSHIYHRLKAKKARATSKPQRHQRADASLREKLLGPKVIGEIRNNSHLGATVPIPTSSPITVNTEIVRQRHGPSSLSEYYYTSARSLSSSPVPMSGTWSANYHQTNSPPEIDDQKESLVSEFSPAQYAASPLIKNSLSVVPWMSLLLGMSVLHFLVGTTHQEVPNGIVIPVGRRLLLLADDHADSSVSNGSGSGIGSFLGWAMAVIYMGGRLPQIWLNMKRGNAEGLNPLMFTFALVGNVTYVGSILVKSMDWSKLKPNLPWLVDAGGCVLLDTFIILQFLYFHYRKRHVPDEPDSADKVENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH
Proper citation: RRID:Addgene_117895 Copy
Species: Oryza sativa
Genetic Insert: OsPQL uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MGIFSGAGAHRPSCPSAANCAKWAQTYLKYCLCSTRDGMALTLGLLSVISWGVAEVPQIITNYKHKSTEGLSLAFLMTWIVGDFFNLIGCFLEPETLPTQFYMALLYTITTVILTGQTVYYSHIYHRLKAKKARATSKPQRHQRADASLREKLLGPKVIGEIRNNSHLGATVPIPTSSPITVNTEIVRQRHGPSSLSEYYYTSARSLSSSPVPMSGTWSANYHQTNSPPEIDDQKESLVSEFSPAQYAASPLIKNSLSVVPWMSLLLGMSVLHFLVGTTHQEVPNGIVIPVGRRLLLLADDHADSSVSNGSGSGIGSFLGWAMAVIYMGGRLPQIWLNMKRGNAEGLNPLMFTFALVGNVTYVGSILVKSMDWSKLKPNLPWLVDAGGCVLLDTFIILQFLYFHYRKRHVPDEPDSADKVENLYQSHHHHHH
Proper citation: RRID:Addgene_117894 Copy
Species: Homo sapiens
Genetic Insert: CnA CnB
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5700; Vector Backbone:pET15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9125515
Proper citation: RRID:Addgene_11787 Copy
Species: Triticum aestivum
Genetic Insert: TaALMT1-uPIC 5'
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117890 Copy
Species: Triticum aestivum
Genetic Insert: TaALMT1-upGFP 3'
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117893 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT1 upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH
Proper citation: RRID:Addgene_117899 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
