Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT1 uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSHHHHHH
Proper citation: RRID:Addgene_117898 Copy
Species: Other
Genetic Insert: YlpTEF
Vector Backbone Description: Backbone Size:2028; Vector Backbone:pIDTSMART-KAN; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30698703
Proper citation: RRID:Addgene_117819 Copy
Species: Homo sapiens
Genetic Insert: ADAR2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28208661
Proper citation: RRID:Addgene_117929 Copy
Species: Synthetic
Genetic Insert: minimal TATA-box promoter with low basal activity
Vector Backbone Description: Backbone Marker:Self made; Derived from pBluescriptSK; Backbone Size:2343; Vector Backbone:pUPD3; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:31836712
Comments: Insert can be released with BsaI
Proper citation: RRID:Addgene_118049 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: erg3-mCherry
Vector Backbone Description: Backbone Size:7549; Vector Backbone:pESC/mCitrine (Addgene plasmid 117995); Vector Types:Plant Expression, Plant/bacteria binary vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945
Proper citation: RRID:Addgene_117993 Copy
Species: Synthetic
Genetic Insert: mCitrine
Vector Backbone Description: Backbone Marker:Agilent Technologies; Backbone Size:6571; Vector Backbone:pESC-URA; Vector Types:Yeast Expression, Yeast/bacteria binary vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945
Proper citation: RRID:Addgene_117996 Copy
Vector Backbone Description: Backbone Marker:Self made; Derived from pBluescriptSK; Backbone Size:2171; Vector Backbone:ColE1 vector Omega1; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression, Synthetic Biology, Assembly of GB2.0 transcriptional units; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:31836712
Comments: This is a BmsBI GB2.0 Omega entry vector. Any assembled unit(s) can be released with BsaI for further cloning into Alfa level vectors.
Proper citation: RRID:Addgene_118046 Copy
Species: Arabidopsis thaliana
Genetic Insert: CURT_fluoB
Vector Backbone Description: Backbone Marker:Agilent Technologies; Backbone Size:6571; Vector Backbone:pESC-URA; Vector Types:Yeast Expression, Yeast/bacteria binary vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945
Proper citation: RRID:Addgene_117997 Copy
Species: Arabidopsis thaliana
Genetic Insert: CURT_fluoB
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:3956; Vector Backbone:pBAD; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945
Proper citation: RRID:Addgene_117999 Copy
Genetic Insert: SpCas9-NG (L1111R/D1135V/G1218R/E1219F/A1322R/R1335V/T1337R)
Vector Backbone Description: Vector Backbone:pX330; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30166441
Proper citation: RRID:Addgene_117919 Copy
Species: Homo sapiens
Genetic Insert: 4 copies the SMAD DNA binding motif
Vector Backbone Description: Backbone Marker:Self made; Derived from pBluescriptSK; Backbone Size:2343; Vector Backbone:pUPD; Vector Types:Mammalian Expression, Synthetic Biology, Domestication of DNA parts for GoldenBraid asembly; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31836712
Comments: Insert can be released with BsaI
Proper citation: RRID:Addgene_118051 Copy
Species: Homo sapiens
Genetic Insert: 2 copies of the p53 DNA binding motif
Vector Backbone Description: Backbone Marker:Self made; Derived from pBluescriptSK; Backbone Size:2343; Vector Backbone:pUPD; Vector Types:Synthetic Biology, Domestication of DNA parts for GoldenBraid asembly; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:31836712
Comments: Insert can be released with BsaI
Proper citation: RRID:Addgene_118053 Copy
Species: Staphylococcus epidermidis
Genetic Insert: SdrG_B2
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5216; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30420680
Proper citation: RRID:Addgene_117982 Copy
Species: Rattus norvegicus
Genetic Insert: GABRG1
Vector Backbone Description: Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_118039 Copy
Species: Staphylococcus epidermidis
Genetic Insert: SdrG_B1
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5216; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30420680
Proper citation: RRID:Addgene_117981 Copy
Species: Oryza sativa
Genetic Insert: OsSLAC1
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MAAKPSSSSSSTGGHHTVDIRAAQAQPEDARQSAMSGPINIRGERRPPPMQRAFSRQVSLGSGVTVLGMDKVGKNGGRGQQRALPRSGKSLGVLNHTGALGQAAAGDGAARRGDFSMFRTKSTLSKQNSLLPSRIREPDLELPPHVEGPSVGRQGGEDPLNKSVPAGRYFAALRGPELDEVRDYEDILLPKDEVWPFLLRFPVGCFGVCLGLGSQAILWGALAASPAMRFLHVTPMINVALWLLALAVLVAVSVTYALKCVFYFEAIRREYFHPVRVNFFFAPSIAAMFLTIGLPRAVAPERLHPAVWCAFVAPLFGLELKIYGQWLSGGKRRLCKVANPSSHLSVVGNFVGAILAARVGWAEAGKFLWAIGVAHYIVVFVTLYQRLPTNEALPKELHPVYSMFIATPSAASLAWAAIYGSFDAVARTFFFMALFLYMSLVVRINFFRGFRFSIAWWSYTFPMTTASLATVKYAEAEPCFTSRALALSLSLMSTTMVSLLLVSTLLHAFVWRSLFPNDLAIAITKDRQNGAFKPHGKGRKAGKRVYDIKRWAKQAPLSLVSSITKSNSADKEEEEKTECGTENLYFQSGSHHHHHHHHHH
Proper citation: RRID:Addgene_117904 Copy
Genetic Insert: sgRNA backbone (F+E)
Vector Backbone Description: Vector Backbone:pCESAx (Addgene 59986); Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30580963
Comments: Users should follow the oligo cloning protocol for plasmid lentiCRISPR v2 (Addgene #52961) to 1) remove stuffer fragment and 2) insert annealed oligos to complete gRNA.
Proper citation: RRID:Addgene_117986 Copy
Species: Arabidopsis thaliana
Genetic Insert: CTP-mCitrine
Vector Backbone Description: Backbone Size:9204; Vector Backbone:pN_35S; Vector Types:Plant Expression, Plant/bacteria binary vector; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:30884945
Comments: mCitrine contains an L7E compared to the published mCitrine sequence that does not impact plasmid function.
Proper citation: RRID:Addgene_117989 Copy
Species: Homo sapiens
Genetic Insert: Clover-Prx2-mRuby2
Vector Backbone Description: Backbone Size:7330; Vector Backbone:pLJM1; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30087344
Proper citation: RRID:Addgene_117907 Copy
Species: Synthetic
Genetic Insert: SNAP_Pro30_[cpNLuc23_24]eDHFR(R98A)
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5218; Vector Backbone:pET51-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30213915
Proper citation: RRID:Addgene_117909 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
