Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 460 showing 9181 ~ 9200 out of 740,584 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_117898

http://www.addgene.org/117898

Species: Arabidopsis thaliana
Genetic Insert: AtCOPT1 uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSHHHHHH

Proper citation: RRID:Addgene_117898 Copy   


  • RRID:Addgene_117819

http://www.addgene.org/117819

Species: Other
Genetic Insert: YlpTEF
Vector Backbone Description: Backbone Size:2028; Vector Backbone:pIDTSMART-KAN; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30698703

Proper citation: RRID:Addgene_117819 Copy   


  • RRID:Addgene_117929

    This resource has 1+ mentions.

http://www.addgene.org/117929

Species: Homo sapiens
Genetic Insert: ADAR2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28208661

Proper citation: RRID:Addgene_117929 Copy   


  • RRID:Addgene_118049

http://www.addgene.org/118049

Species: Synthetic
Genetic Insert: minimal TATA-box promoter with low basal activity
Vector Backbone Description: Backbone Marker:Self made; Derived from pBluescriptSK; Backbone Size:2343; Vector Backbone:pUPD3; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:31836712
Comments: Insert can be released with BsaI

Proper citation: RRID:Addgene_118049 Copy   


http://www.addgene.org/117993

Species: Saccharomyces cerevisiae
Genetic Insert: erg3-mCherry
Vector Backbone Description: Backbone Size:7549; Vector Backbone:pESC/mCitrine (Addgene plasmid 117995); Vector Types:Plant Expression, Plant/bacteria binary vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945

Proper citation: RRID:Addgene_117993 Copy   


  • RRID:Addgene_117996

http://www.addgene.org/117996

Species: Synthetic
Genetic Insert: mCitrine
Vector Backbone Description: Backbone Marker:Agilent Technologies; Backbone Size:6571; Vector Backbone:pESC-URA; Vector Types:Yeast Expression, Yeast/bacteria binary vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945

Proper citation: RRID:Addgene_117996 Copy   


  • RRID:Addgene_118046

    This resource has 1+ mentions.

http://www.addgene.org/118046

Vector Backbone Description: Backbone Marker:Self made; Derived from pBluescriptSK; Backbone Size:2171; Vector Backbone:ColE1 vector Omega1; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression, Synthetic Biology, Assembly of GB2.0 transcriptional units; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:31836712
Comments: This is a BmsBI GB2.0 Omega entry vector. Any assembled unit(s) can be released with BsaI for further cloning into Alfa level vectors.

Proper citation: RRID:Addgene_118046 Copy   


  • RRID:Addgene_117997

http://www.addgene.org/117997

Species: Arabidopsis thaliana
Genetic Insert: CURT_fluoB
Vector Backbone Description: Backbone Marker:Agilent Technologies; Backbone Size:6571; Vector Backbone:pESC-URA; Vector Types:Yeast Expression, Yeast/bacteria binary vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945

Proper citation: RRID:Addgene_117997 Copy   


  • RRID:Addgene_117999

http://www.addgene.org/117999

Species: Arabidopsis thaliana
Genetic Insert: CURT_fluoB
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:3956; Vector Backbone:pBAD; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945

Proper citation: RRID:Addgene_117999 Copy   


  • RRID:Addgene_117919

    This resource has 10+ mentions.

http://www.addgene.org/117919

Genetic Insert: SpCas9-NG (L1111R/D1135V/G1218R/E1219F/A1322R/R1335V/T1337R)
Vector Backbone Description: Vector Backbone:pX330; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30166441

Proper citation: RRID:Addgene_117919 Copy   


  • RRID:Addgene_118051

http://www.addgene.org/118051

Species: Homo sapiens
Genetic Insert: 4 copies the SMAD DNA binding motif
Vector Backbone Description: Backbone Marker:Self made; Derived from pBluescriptSK; Backbone Size:2343; Vector Backbone:pUPD; Vector Types:Mammalian Expression, Synthetic Biology, Domestication of DNA parts for GoldenBraid asembly; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31836712
Comments: Insert can be released with BsaI

Proper citation: RRID:Addgene_118051 Copy   


  • RRID:Addgene_118053

http://www.addgene.org/118053

Species: Homo sapiens
Genetic Insert: 2 copies of the p53 DNA binding motif
Vector Backbone Description: Backbone Marker:Self made; Derived from pBluescriptSK; Backbone Size:2343; Vector Backbone:pUPD; Vector Types:Synthetic Biology, Domestication of DNA parts for GoldenBraid asembly; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:31836712
Comments: Insert can be released with BsaI

Proper citation: RRID:Addgene_118053 Copy   


http://www.addgene.org/117982

Species: Staphylococcus epidermidis
Genetic Insert: SdrG_B2
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5216; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30420680

Proper citation: RRID:Addgene_117982 Copy   


http://www.addgene.org/118039

Species: Rattus norvegicus
Genetic Insert: GABRG1
Vector Backbone Description: Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_118039 Copy   


http://www.addgene.org/117981

Species: Staphylococcus epidermidis
Genetic Insert: SdrG_B1
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5216; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30420680

Proper citation: RRID:Addgene_117981 Copy   


  • RRID:Addgene_117904

http://www.addgene.org/117904

Species: Oryza sativa
Genetic Insert: OsSLAC1
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MAAKPSSSSSSTGGHHTVDIRAAQAQPEDARQSAMSGPINIRGERRPPPMQRAFSRQVSLGSGVTVLGMDKVGKNGGRGQQRALPRSGKSLGVLNHTGALGQAAAGDGAARRGDFSMFRTKSTLSKQNSLLPSRIREPDLELPPHVEGPSVGRQGGEDPLNKSVPAGRYFAALRGPELDEVRDYEDILLPKDEVWPFLLRFPVGCFGVCLGLGSQAILWGALAASPAMRFLHVTPMINVALWLLALAVLVAVSVTYALKCVFYFEAIRREYFHPVRVNFFFAPSIAAMFLTIGLPRAVAPERLHPAVWCAFVAPLFGLELKIYGQWLSGGKRRLCKVANPSSHLSVVGNFVGAILAARVGWAEAGKFLWAIGVAHYIVVFVTLYQRLPTNEALPKELHPVYSMFIATPSAASLAWAAIYGSFDAVARTFFFMALFLYMSLVVRINFFRGFRFSIAWWSYTFPMTTASLATVKYAEAEPCFTSRALALSLSLMSTTMVSLLLVSTLLHAFVWRSLFPNDLAIAITKDRQNGAFKPHGKGRKAGKRVYDIKRWAKQAPLSLVSSITKSNSADKEEEEKTECGTENLYFQSGSHHHHHHHHHH

Proper citation: RRID:Addgene_117904 Copy   


  • RRID:Addgene_117986

    This resource has 10+ mentions.

http://www.addgene.org/117986

Genetic Insert: sgRNA backbone (F+E)
Vector Backbone Description: Vector Backbone:pCESAx (Addgene 59986); Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30580963
Comments: Users should follow the oligo cloning protocol for plasmid lentiCRISPR v2 (Addgene #52961) to 1) remove stuffer fragment and 2) insert annealed oligos to complete gRNA.

Proper citation: RRID:Addgene_117986 Copy   


  • RRID:Addgene_117989

    This resource has 1+ mentions.

http://www.addgene.org/117989

Species: Arabidopsis thaliana
Genetic Insert: CTP-mCitrine
Vector Backbone Description: Backbone Size:9204; Vector Backbone:pN_35S; Vector Types:Plant Expression, Plant/bacteria binary vector; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:30884945
Comments: mCitrine contains an L7E compared to the published mCitrine sequence that does not impact plasmid function.

Proper citation: RRID:Addgene_117989 Copy   


http://www.addgene.org/117907

Species: Homo sapiens
Genetic Insert: Clover-Prx2-mRuby2
Vector Backbone Description: Backbone Size:7330; Vector Backbone:pLJM1; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30087344

Proper citation: RRID:Addgene_117907 Copy   


http://www.addgene.org/117909

Species: Synthetic
Genetic Insert: SNAP_Pro30_[cpNLuc23_24]eDHFR(R98A)
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5218; Vector Backbone:pET51-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30213915

Proper citation: RRID:Addgene_117909 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X