Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
AtCOPT1 uPIC Resource Report Resource Website |
RRID:Addgene_117898 | AtCOPT1 uPIC | Arabidopsis thaliana | Bleocin (Zeocin) | insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSHHHHHH | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-08-15 01:02:58 | 0 | ||
|
BB1_12_YlpTEF Resource Report Resource Website |
RRID:Addgene_117819 | YlpTEF | Other | Kanamycin | PMID:30698703 | Backbone Size:2028; Vector Backbone:pIDTSMART-KAN; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:02:58 | 0 | ||
|
pmGFP-ADAR2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_117929 | ADAR2 | Homo sapiens | Ampicillin | PMID:28208661 | Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:02:59 | 1 | ||
|
pMiniP Resource Report Resource Website |
RRID:Addgene_118049 | minimal TATA-box promoter with low basal activity | Synthetic | Chloramphenicol | PMID:31836712 | Insert can be released with BsaI | Backbone Marker:Self made; Derived from pBluescriptSK; Backbone Size:2343; Vector Backbone:pUPD3; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Chloramphenicol | 2026-08-15 01:02:59 | 0 | |
|
pESC/mCitrine/erg3-mCherry Resource Report Resource Website |
RRID:Addgene_117993 | erg3-mCherry | Saccharomyces cerevisiae | Ampicillin | PMID:30884945 | Backbone Size:7549; Vector Backbone:pESC/mCitrine (Addgene plasmid 117995); Vector Types:Plant Expression, Plant/bacteria binary vector; Bacterial Resistance:Ampicillin | 2026-08-15 01:02:59 | 0 | ||
|
pESC/mCitrine Resource Report Resource Website |
RRID:Addgene_117996 | mCitrine | Synthetic | Ampicillin | PMID:30884945 | Backbone Marker:Agilent Technologies; Backbone Size:6571; Vector Backbone:pESC-URA; Vector Types:Yeast Expression, Yeast/bacteria binary vector; Bacterial Resistance:Ampicillin | 2026-08-15 01:02:59 | 0 | ||
|
Omega 1 Resource Report Resource Website 1+ mentions |
RRID:Addgene_118046 | Chloramphenicol | PMID:31836712 | This is a BmsBI GB2.0 Omega entry vector. Any assembled unit(s) can be released with BsaI for further cloning into Alfa level vectors. | Backbone Marker:Self made; Derived from pBluescriptSK; Backbone Size:2171; Vector Backbone:ColE1 vector Omega1; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression, Synthetic Biology, Assembly of GB2.0 transcriptional units; Bacterial Resistance:Chloramphenicol | 2026-08-15 01:02:59 | 1 | |||
|
pESC/CURT_fluoB Resource Report Resource Website |
RRID:Addgene_117997 | CURT_fluoB | Arabidopsis thaliana | Ampicillin | PMID:30884945 | Backbone Marker:Agilent Technologies; Backbone Size:6571; Vector Backbone:pESC-URA; Vector Types:Yeast Expression, Yeast/bacteria binary vector; Bacterial Resistance:Ampicillin | 2026-08-15 01:02:59 | 0 | ||
|
pBAD/CURT_fluoB Resource Report Resource Website |
RRID:Addgene_117999 | CURT_fluoB | Arabidopsis thaliana | Ampicillin | PMID:30884945 | Backbone Marker:Invitrogen; Backbone Size:3956; Vector Backbone:pBAD; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:02:59 | 0 | ||
|
pX330-SpCas9-NG Resource Report Resource Website 10+ mentions |
RRID:Addgene_117919 | SpCas9-NG (L1111R/D1135V/G1218R/E1219F/A1322R/R1335V/T1337R) | Ampicillin | PMID:30166441 | Vector Backbone:pX330; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:02:59 | 13 | |||
|
p4xSMAD_RE Resource Report Resource Website |
RRID:Addgene_118051 | 4 copies the SMAD DNA binding motif | Homo sapiens | Ampicillin | PMID:31836712 | Insert can be released with BsaI | Backbone Marker:Self made; Derived from pBluescriptSK; Backbone Size:2343; Vector Backbone:pUPD; Vector Types:Mammalian Expression, Synthetic Biology, Domestication of DNA parts for GoldenBraid asembly; Bacterial Resistance:Ampicillin | 2026-08-15 01:02:59 | 0 | |
|
p2xp53_RE Resource Report Resource Website |
RRID:Addgene_118053 | 2 copies of the p53 DNA binding motif | Homo sapiens | Chloramphenicol | PMID:31836712 | Insert can be released with BsaI | Backbone Marker:Self made; Derived from pBluescriptSK; Backbone Size:2343; Vector Backbone:pUPD; Vector Types:Synthetic Biology, Domestication of DNA parts for GoldenBraid asembly; Bacterial Resistance:Chloramphenicol | 2026-08-15 01:03:00 | 0 | |
|
pET28a-MGGG-ybbr-HIS-SdrG_B2-DK Resource Report Resource Website |
RRID:Addgene_117982 | SdrG_B2 | Staphylococcus epidermidis | Kanamycin | PMID:30420680 | Backbone Marker:EMD Biosciences; Backbone Size:5216; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:02:59 | 0 | ||
|
Myc-gamma1 (in pCAGGS) Resource Report Resource Website |
RRID:Addgene_118039 | GABRG1 | Rattus norvegicus | Ampicillin | Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:02:59 | 0 | |||
|
pET28a-MGGG-ybbr-HIS-SdrG_B1-DK Resource Report Resource Website |
RRID:Addgene_117981 | SdrG_B1 | Staphylococcus epidermidis | Kanamycin | PMID:30420680 | Backbone Marker:EMD Biosciences; Backbone Size:5216; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:02:59 | 0 | ||
|
OsSLAC1 Resource Report Resource Website |
RRID:Addgene_117904 | OsSLAC1 | Oryza sativa | Bleocin (Zeocin) | insert amino acid sequence: MAAKPSSSSSSTGGHHTVDIRAAQAQPEDARQSAMSGPINIRGERRPPPMQRAFSRQVSLGSGVTVLGMDKVGKNGGRGQQRALPRSGKSLGVLNHTGALGQAAAGDGAARRGDFSMFRTKSTLSKQNSLLPSRIREPDLELPPHVEGPSVGRQGGEDPLNKSVPAGRYFAALRGPELDEVRDYEDILLPKDEVWPFLLRFPVGCFGVCLGLGSQAILWGALAASPAMRFLHVTPMINVALWLLALAVLVAVSVTYALKCVFYFEAIRREYFHPVRVNFFFAPSIAAMFLTIGLPRAVAPERLHPAVWCAFVAPLFGLELKIYGQWLSGGKRRLCKVANPSSHLSVVGNFVGAILAARVGWAEAGKFLWAIGVAHYIVVFVTLYQRLPTNEALPKELHPVYSMFIATPSAASLAWAAIYGSFDAVARTFFFMALFLYMSLVVRINFFRGFRFSIAWWSYTFPMTTASLATVKYAEAEPCFTSRALALSLSLMSTTMVSLLLVSTLLHAFVWRSLFPNDLAIAITKDRQNGAFKPHGKGRKAGKRVYDIKRWAKQAPLSLVSSITKSNSADKEEEEKTECGTENLYFQSGSHHHHHHHHHH | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-08-15 01:02:59 | 0 | ||
|
pLentiGuide Resource Report Resource Website 10+ mentions |
RRID:Addgene_117986 | sgRNA backbone (F+E) | Ampicillin | PMID:30580963 | Users should follow the oligo cloning protocol for plasmid lentiCRISPR v2 (Addgene #52961) to 1) remove stuffer fragment and 2) insert annealed oligos to complete gRNA. | Vector Backbone:pCESAx (Addgene 59986); Vector Types:Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:02:59 | 14 | ||
|
pN_35S/CTP-mCitrine Resource Report Resource Website 1+ mentions |
RRID:Addgene_117989 | CTP-mCitrine | Arabidopsis thaliana | Spectinomycin | PMID:30884945 | mCitrine contains an L7E compared to the published mCitrine sequence that does not impact plasmid function. | Backbone Size:9204; Vector Backbone:pN_35S; Vector Types:Plant Expression, Plant/bacteria binary vector; Bacterial Resistance:Spectinomycin | 2026-08-15 01:02:59 | 1 | |
|
pLJM1-Clover-Prx2-mRuby2 Resource Report Resource Website |
RRID:Addgene_117907 | Clover-Prx2-mRuby2 | Homo sapiens | Ampicillin | PMID:30087344 | Backbone Size:7330; Vector Backbone:pLJM1; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:02:59 | 0 | ||
|
pET51b(+)-NADPH-LUCID-2 (C50 29 nM) Resource Report Resource Website |
RRID:Addgene_117909 | SNAP_Pro30_[cpNLuc23_24]eDHFR(R98A) | Synthetic | Ampicillin | PMID:30213915 | Backbone Marker:Novagen; Backbone Size:5218; Vector Backbone:pET51-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | R98A on eDHFR | 2026-08-15 01:02:58 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
