Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Facets


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

740,584 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
FH-Tet2-pEF
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_41710 tet methylcytosine dioxygenase 2 Mus musculus Ampicillin PMID:21057493 Backbone Marker:Invitrogen; Backbone Size:6174; Vector Backbone:pEF1a; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:14:47 9
pcDNA3.1(+)mGAT1CFP45
 
Resource Report
Resource Website
RRID:Addgene_41676 Mus musculus GABA transporter 1 Mus musculus Ampicillin PMID:19948998 To generate the fluorescent mutants mGAT10XFP and mGAT1XFP* through mGAT1XFP45, the wild-type mGAT1 open reading frame (ORF) was subcloned without its original stop codon into the HindIII and EcoRI sites of the pcDNA3.1(+) expression vector multiple cloning site (MCS). XFP ORFs were then subcloned downstream from and in frame with the mGAT1 ORF at the NotI and XbaI sites of the pcDNA3.1(+) MCS. This resulted in a 12–amino acid spacer between the end of the mGAT1 sequence and the beginning of the fluorophore. The depositors modified a method for the integration of PCR fragments without the use of restriction enzymes (Geiser et al., 2001) to add the final 3, 8, 20, 28, or 45 codons of the human GAT1 (hGAT1) ORF. These were amplified from a source plasmid using the proof-reading PfuTurbo Cx Hotstart polymerase with 5′ and 3′ extensions corresponding to the 20–22-nt regions that flanked the intended site of insertion, such that the PCR product integrated in-frame immediately after the fluorophore sequence when used as the primers in a subsequent QuikChange II XL mutagenesis PCR reaction. For mGAT1XFP*, the depositors simply added a GTC codon for Val after the fluorophore ORF. The attached image displays the protein sequences of the modified regions of mGAT1 for each fluorescent construct. mGAT10CFP and mGAT10YFP repeated the fusion design of mGAT10GFP but with the fluorophore exchanged as annotated. The three C-terminal residues of the mGAT0XFP fusions are -YKI-CO2−, which comprises a broadly defined consensus PDZ class II–interacting motif (X-φ-X-φ, where φ designates a hydrophobic residue and X any residue) (Sheng and Sala, 2001; Hung and Sheng, 2002). The depositors searched the Ensembl databases using Biomart (http://www.ebi.ac.uk/biomart) (Spudich et al., 2007) and applied the GO:0005886 “plasma membrane” cellular component filter. The search identified no known membrane proteins possessing the -YKI-CO2− C-terminal sequence. In the mGAT1XFP* constructs, the depositors defined the terminal residue P(0) more narrowly, changing the terminal isoleucine residue present in mGAT10XFP to a valine in mGAT1XFP*. The resulting C-terminal sequence, -YKV-CO2−, reconstituted a functional PDZ class II–interacting motif present in Ephrin B receptors, a class that relies on interactions with the PDZ domain–containing proteins for clustering (Torres et al., 1998; Brückner et al., 1999; Lin et al., 1999; Madsen et al., 2005). Other constructs in the C-terminal XFP fusion series, mGAT1XFP3, mGAT1XFP8, mGAT1XFP20, mGAT1XFP28, and mGAT1XFP45, had the most C-terminal 3, 8, 20, 28, or 45 residues of the hGAT1 appended after the mGAT1XFP fusion. The differences in nucleotide sequence between the hGAT1 and mGAT1 C termini were a useful source of positive identification when the depositors analyzed the clones during construction. PCR integration was applied to amplify and insert EYFP or ECFP directly between residues R565 and L566, I570 and Q571, or V577 and R578 of mGAT1 to generate the mGAT15xxXFP5xxCT constructs. The site of XFP insertion in GAT1 is highlighted in the nomenclatures for these constructs by residue numbers flanking the fluorophore, and the “CT” denotes that the insertion occurs within the C terminus. Please see the associated article for more detailed information regarding construct creation and usage. Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin “Monomerizing” CFP A206K mutation; 45 C-terminal-most residues of hGAT1 (MFLALKGSLKQRIQVMVQPSEDIVRPENGPEQPQAGSSTSKEAYI) appended after CFP 2026-08-15 01:14:47 0
pAAH6
 
Resource Report
Resource Website
RRID:Addgene_41830 Ampicillin PMID:21393538 Backbone Marker:Covalys; Backbone Size:3724; Vector Backbone:pSET7-26b; Vector Types:Bacterial Expression, Yeast Expression, PCR template; Bacterial Resistance:Ampicillin 2026-08-15 01:14:48 0
pcDNA3.1(+)mGAT1YFP45
 
Resource Report
Resource Website
RRID:Addgene_41675 Mus musculus GABA transporter 1 Mus musculus Ampicillin PMID:19948998 To generate the fluorescent mutants mGAT10XFP and mGAT1XFP* through mGAT1XFP45, the wild-type mGAT1 open reading frame (ORF) was subcloned without its original stop codon into the HindIII and EcoRI sites of the pcDNA3.1(+) expression vector multiple cloning site (MCS). XFP ORFs were then subcloned downstream from and in frame with the mGAT1 ORF at the NotI and XbaI sites of the pcDNA3.1(+) MCS. This resulted in a 12–amino acid spacer between the end of the mGAT1 sequence and the beginning of the fluorophore. The depositors modified a method for the integration of PCR fragments without the use of restriction enzymes (Geiser et al., 2001) to add the final 3, 8, 20, 28, or 45 codons of the human GAT1 (hGAT1) ORF. These were amplified from a source plasmid using the proof-reading PfuTurbo Cx Hotstart polymerase with 5′ and 3′ extensions corresponding to the 20–22-nt regions that flanked the intended site of insertion, such that the PCR product integrated in-frame immediately after the fluorophore sequence when used as the primers in a subsequent QuikChange II XL mutagenesis PCR reaction. For mGAT1XFP*, the depositors simply added a GTC codon for Val after the fluorophore ORF. The attached image displays the protein sequences of the modified regions of mGAT1 for each fluorescent construct. mGAT10CFP and mGAT10YFP repeated the fusion design of mGAT10GFP but with the fluorophore exchanged as annotated. The three C-terminal residues of the mGAT0XFP fusions are -YKI-CO2−, which comprises a broadly defined consensus PDZ class II–interacting motif (X-φ-X-φ, where φ designates a hydrophobic residue and X any residue) (Sheng and Sala, 2001; Hung and Sheng, 2002). The depositors searched the Ensembl databases using Biomart (http://www.ebi.ac.uk/biomart) (Spudich et al., 2007) and applied the GO:0005886 “plasma membrane” cellular component filter. The search identified no known membrane proteins possessing the -YKI-CO2− C-terminal sequence. In the mGAT1XFP* constructs, the depositors defined the terminal residue P(0) more narrowly, changing the terminal isoleucine residue present in mGAT10XFP to a valine in mGAT1XFP*. The resulting C-terminal sequence, -YKV-CO2−, reconstituted a functional PDZ class II–interacting motif present in Ephrin B receptors, a class that relies on interactions with the PDZ domain–containing proteins for clustering (Torres et al., 1998; Brückner et al., 1999; Lin et al., 1999; Madsen et al., 2005). Other constructs in the C-terminal XFP fusion series, mGAT1XFP3, mGAT1XFP8, mGAT1XFP20, mGAT1XFP28, and mGAT1XFP45, had the most C-terminal 3, 8, 20, 28, or 45 residues of the hGAT1 appended after the mGAT1XFP fusion. The differences in nucleotide sequence between the hGAT1 and mGAT1 C termini were a useful source of positive identification when the depositors analyzed the clones during construction. PCR integration was applied to amplify and insert EYFP or ECFP directly between residues R565 and L566, I570 and Q571, or V577 and R578 of mGAT1 to generate the mGAT15xxXFP5xxCT constructs. The site of XFP insertion in GAT1 is highlighted in the nomenclatures for these constructs by residue numbers flanking the fluorophore, and the “CT” denotes that the insertion occurs within the C terminus. Please see the associated article for more detailed information regarding construct creation and usage. Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin “Monomerizing” YFP A206K mutation; 45 C-terminal-most residues of hGAT1 (MFLALKGSLKQRIQVMVQPSEDIVRPENGPEQPQAGSSTSKEAYI) appended after YFP 2026-08-15 01:14:47 0
p156RRL-EF1a-GFP-U3H1SatA
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_41795 satellite repeat sequence Ampicillin PMID:21901007 Vector Backbone:p156RRLsinpptCAGPRE; Vector Types:; Bacterial Resistance:Ampicillin 2026-08-15 01:14:48 1
pCD/NL-BH∆1
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_41791 HIV-1 Gag/Pol and RRE sequences Ampicillin PMID:22612657 Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:14:48 2
pAAH2
 
Resource Report
Resource Website
RRID:Addgene_41826 Ampicillin PMID:21393538 Backbone Marker:Paul Matsudaira lab; Backbone Size:3322; Vector Backbone:pAED4; Vector Types:Bacterial Expression, Yeast Expression, PCR template; Bacterial Resistance:Ampicillin 2026-08-15 01:14:48 0
pAAH1
 
Resource Report
Resource Website
RRID:Addgene_41825 Ampicillin PMID:21393538 Backbone Marker:Paul Matsudaira lab; Backbone Size:3322; Vector Backbone:pAED4; Vector Types:Bacterial Expression, Yeast Expression, PCR template; Bacterial Resistance:Ampicillin 2026-08-15 01:14:48 0
gRNA_DNMT3b
 
Resource Report
Resource Website
RRID:Addgene_41823 gRNA_DNMT3b Homo sapiens Kanamycin PMID:23287722 gRNA target sequence GAATTACTCACGCCCCAAGG Backbone Marker:Invitrogen; Vector Backbone:pCR-Blunt II-TOPO; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Kanamycin 2026-08-15 01:14:48 0
EcNR2.dnaG.Q576A
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_41700 E. coli MG1655 ΔmutS::cat Δ(ybhB-bioAB)::[λcI857 N(cro-ea59)::tetR-bla] dnaG.Q576A Ampicillin PMID:22904085 Vector Backbone:genome; Vector Types:; Bacterial Resistance:Ampicillin 2026-08-15 01:14:47 3
pAAH4
 
Resource Report
Resource Website
RRID:Addgene_41828 Ampicillin PMID:21393538 Backbone Size:3580; Vector Backbone:pUG66; Vector Types:Yeast Expression, PCR template; Bacterial Resistance:Ampicillin 2026-08-15 01:14:48 0
H9 pMalLP
 
Resource Report
Resource Website
RRID:Addgene_41811 H9 Super-2 Homo sapiens Ampicillin PMID:22446627 This is an e. coli periplasmic expression vector. H9 has the following mutations compared to wildtype IL-2: L80F, R81F, L85V, I86V, I92F Backbone Size:6700; Vector Backbone:pMalLP; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:14:48 0
IL2 F42A pAcGP67a
 
Resource Report
Resource Website
RRID:Addgene_41807 IL2 Homo sapiens Ampicillin PMID:22446627 Backbone Marker:BD; Backbone Size:9761; Vector Backbone:pAcGP67a; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin Phenylalanine 42 to Alanine 2026-08-15 01:14:48 0
IL2 pAcGP67a
 
Resource Report
Resource Website
RRID:Addgene_41806 IL2 Homo sapiens Ampicillin PMID:22446627 Backbone Marker:BD; Backbone Size:9761; Vector Backbone:pAcGP67a; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:14:48 0
pDM8
 
Resource Report
Resource Website
RRID:Addgene_41758 kinesin heavy chain Drosophila melanogaster Ampicillin PMID:20212149 Vector Backbone:pT7-7; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin residues 1-401; C45S C338S S364C C451S 2026-08-15 01:14:48 0
pAP2
 
Resource Report
Resource Website
RRID:Addgene_41755 kinesin heavy chain Drosophila melanogaster Ampicillin PMID:20212149 Vector Backbone:pT7-7; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin residues 1-401; C45S C338S K349C C451S 2026-08-15 01:14:48 0
pOU1
 
Resource Report
Resource Website
RRID:Addgene_41753 kinesin heavy chain Drosophila melanogaster Ampicillin PMID:20212149 Vector Backbone:pT7-7; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin residues 1-401; C338S C451S 2026-08-15 01:14:48 0
HA-EGFP-HaloTag2
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_41742 Halotag 2 Homo sapiens Ampicillin PMID:21725302 Alternate plasmid name: pCDNA5-KGH2 Backbone Marker:INVITROGEN; Backbone Size:5000; Vector Backbone:PCDNA5; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:14:48 5
pSR-siKlf5
 
Resource Report
Resource Website
RRID:Addgene_41740 Klf5 Mus musculus Ampicillin PMID:17158781 Backbone Marker:Oligoengine; Vector Backbone:pSuper-Retro; Vector Types:RNAi; Bacterial Resistance:Ampicillin 2026-08-15 01:14:48 0
Nuc5-.dnaG.Q576A.tolC-
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_41699 E. coli MG1655 ΔmutS::cat Δ(ybhB-bioAB)::[λcI857 N(cro-ea59)::tetR-bla] xonA-, recJ-,xseA-, exoX- and redα- dnaG.Q576A tolC- Ampicillin PMID:22904085 Vector Backbone:genome; Vector Types:; Bacterial Resistance:Ampicillin 2026-08-15 01:14:47 1

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.