Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Arabidopsis thaliana
Genetic Insert: GPA1
Vector Backbone Description: Backbone Marker:GE Healthcare; Backbone Size:4523; Vector Backbone:pSTTa (from pGEX); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:40260404
Comments: Additional details regarding the physiological roles of this mutant GPA1 protein can be found at PMID: 31690635.
Proper citation: RRID:Addgene_248649 Copy
Species: E. coli
Genetic Insert: LplA
Vector Backbone Description: Vector Backbone:pcDNA3 ; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:41505504
Comments: Please visit https://doi.org/10.1101/2025.05.03.652001 for bioRxiv preprint.
Proper citation: RRID:Addgene_248807 Copy
Species: Mus musculus
Genetic Insert: Sparcl1
Vector Backbone Description: Vector Backbone:pAAV2; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:41720089
Proper citation: RRID:Addgene_249180 Copy
Species: Homo sapiens
Genetic Insert: CRY2-fused FLAG-tagged STIM1 fragment (a.a.238-685)
Vector Backbone Description: Backbone Size:2879; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37848907
Comments: STIM1(238-685)
KEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK
Proper citation: RRID:Addgene_248299 Copy
Species: Homo sapiens
Genetic Insert: FBXO31
Vector Backbone Description: Vector Backbone:pLenti-X1; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:39880951
Proper citation: RRID:Addgene_250257 Copy
Species: Synthetic
Genetic Insert: GST-L3C9-1
Vector Backbone Description: Vector Backbone:pGEX; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:41481455
Proper citation: RRID:Addgene_248851 Copy
Species: Synthetic
Genetic Insert: GST-L3AN-1
Vector Backbone Description: Vector Backbone:pGEX; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:41481455
Proper citation: RRID:Addgene_248852 Copy
Genetic Insert: EGFP and CRY2-fused STIM1 fragment (a.a.238-448)
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3946; Vector Backbone:pCMV; Vector Types:; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37848907
Comments: CRY2(E281A) MKMDKKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSLKALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSIESVMLPPPWRLMPITAAAEAIWACSIEELGLENEAEKPSNALLTRAWSPGWSNADKLLNEFIEKQLIDYAKNSKKVVGNSTSLLSPYLHFGEISVRHVFQCARMKQIIWARDKNSEGAESADLFLRGIGLREYSRYICFNFPFTHEQSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIRVIVSSFAVKFLLLPWKWGMKYFWDTLLDADLECDILGWQYISGSIPDGHELDRLDNPALQGAKYDPEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNYAKPIVDIDTARELLAKAISRTREAQIMIGAA
STIM1(238-448)
KEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIH
Proper citation: RRID:Addgene_248295 Copy
Species: Homo sapiens
Genetic Insert: CIBN-fused STIM1 fragment (a.a.238-685)
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3953; Vector Backbone:pCMV; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37848907
Comments: CIBN
MNGAIGGDLLLNFPDMSVLERQRAHLKYLNPTFDSPLAGFFADSSMITGGEMDSYLSTAGLNLPMMYGETTVEGDSRLSISPETTLGTGNFKAAKFDTETKDCNEAAKKMTMNRDDLVEEGEEEKSKITEQNNGSTKSIKKMKHKAKKEENNFSNDSSKVTKELEKTDYI
STIM1(238-685)
KEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK
Proper citation: RRID:Addgene_248296 Copy
Genetic Insert: GFP nanobody (vhhGFP) fused to CRY2
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3937; Vector Backbone:pCMV; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37848907
Comments: vhhGFP
MVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVSS
CRY2(E281A) MKMDKKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSLKALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSIESVMLPPPWRLMPITAAAEAIWACSIEELGLENEAEKPSNALLTRAWSPGWSNADKLLNEFIEKQLIDYAKNSKKVVGNSTSLLSPYLHFGEISVRHVFQCARMKQIIWARDKNSEGAESADLFLRGIGLREYSRYICFNFPFTHEQSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIRVIVSSFAVKFLLLPWKWGMKYFWDTLLDADLECDILGWQYISGSIPDGHELDRLDNPALQGAKYDPEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNYAKPIVDIDTARELLAKAISRTREAQIMIGAA
Proper citation: RRID:Addgene_248298 Copy
Species: Synthetic
Genetic Insert: GST-L3LU-2
Vector Backbone Description: Vector Backbone:pGEX; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:41481455
Proper citation: RRID:Addgene_248857 Copy
Species: Synthetic
Genetic Insert: GST-D3LU-1
Vector Backbone Description: Vector Backbone:pGEX; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:41481455
Proper citation: RRID:Addgene_248858 Copy
Species: Synthetic
Genetic Insert: GST-L3LU-1
Vector Backbone Description: Vector Backbone:pGEX; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:41481455
Proper citation: RRID:Addgene_248856 Copy
Species: Ebola virus/H.sapiens-tc/COD/1976/Yambuku-Mayinga
Genetic Insert: Zeocin-eGFP fusion gene flanked by EBOV 5'UTR and 3'UTR
Vector Backbone Description: Backbone Marker:Genscript; Backbone Size:2942; Vector Backbone:pUC57; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Please visit https://doi.org/10.1101/2025.01.09.632058 for bioRxiv preprint.
Proper citation: RRID:Addgene_249393 Copy
Species: Synthetic
Genetic Insert: pGEX-GST-L3A2-3
Vector Backbone Description: Vector Backbone:pGEX; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:41481455
Proper citation: RRID:Addgene_248586 Copy
Species: Homo sapiens
Genetic Insert: GNAS
Vector Backbone Description: Backbone Marker:Addgene #38121; Vector Backbone:pCEFL; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:41460725
Comments: Please visit https://www.biorxiv.org/content/10.1101/2025.02.21.639530v1 for bioRxiv preprint
Proper citation: RRID:Addgene_249278 Copy
Species: Homo sapiens
Genetic Insert: Tau (2N4R)
Vector Backbone Description: Backbone Size:3256; Vector Backbone:pT7II; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:41791447
Proper citation: RRID:Addgene_249556 Copy
Genetic Insert: Tau (0N4R)
Vector Backbone Description: Backbone Size:3256; Vector Backbone:pT7II; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:41791447
Proper citation: RRID:Addgene_249555 Copy
Species: Homo sapiens
Genetic Insert: GNAS
Vector Backbone Description: Backbone Marker:Addgene #38121; Vector Backbone:pCEFL; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:41460725
Comments: Please visit https://www.biorxiv.org/content/10.1101/2025.02.21.639530v1 for bioRxiv preprint
Proper citation: RRID:Addgene_249277 Copy
Species: Homo sapiens
Genetic Insert: GNAS
Vector Backbone Description: Backbone Marker:Addgene #38121; Vector Backbone:pCEFL; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:41460725
Comments: Please visit https://www.biorxiv.org/content/10.1101/2025.02.21.639530v1 for bioRxiv preprint
Proper citation: RRID:Addgene_249276 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
