Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Authority:addgene (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

178,636 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
pFUSB4_TTCT
 
Resource Report
Resource Website
RRID:Addgene_48615 RVD sequence: NG NG HD NG Synthetic Spectinomycin PMID:23734242 Plasmid was created using Golden Gate cloning. Vector Backbone:pFUS_B4; Vector Types:Mammalian Expression, TALEN; Bacterial Resistance:Spectinomycin 2026-09-01 09:55:59 0
pFUSB4_TTCG
 
Resource Report
Resource Website
RRID:Addgene_48614 RVD sequence: NG NG HD NN Synthetic Spectinomycin PMID:23734242 Plasmid was created using Golden Gate cloning. Vector Backbone:pFUS_B4; Vector Types:Mammalian Expression, TALEN; Bacterial Resistance:Spectinomycin 2026-09-01 09:55:59 0
pFUSB4_TTCC
 
Resource Report
Resource Website
RRID:Addgene_48613 RVD sequence: NG NG HD HD Synthetic Spectinomycin PMID:23734242 Plasmid was created using Golden Gate cloning. Vector Backbone:pFUS_B4; Vector Types:Mammalian Expression, TALEN; Bacterial Resistance:Spectinomycin 2026-09-01 09:55:59 0
pFRT-TODestFLAGHAhFMRPiso1I304N
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_48692 FlagHA FMR1 Iso 1 I304N Homo sapiens Ampicillin PMID:23235829 Backbone Marker:Life Technologies, Modified by Tuschl Lab; Backbone Size:5322; Vector Backbone:pcDNA5/FRT/TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 09:56:00 3
pFUSB4_TTAA
 
Resource Report
Resource Website
RRID:Addgene_48608 RVD sequence: NG NG NI NI Synthetic Spectinomycin PMID:23734242 Plasmid was created using Golden Gate cloning. Vector Backbone:pFUS_B4; Vector Types:Mammalian Expression, TALEN; Bacterial Resistance:Spectinomycin 2026-09-01 09:55:59 0
pFUSB4_TGTG
 
Resource Report
Resource Website
RRID:Addgene_48606 RVD sequence: NG NN NG NN Synthetic Spectinomycin PMID:23734242 Plasmid was created using Golden Gate cloning. Vector Backbone:pFUS_B4; Vector Types:Mammalian Expression, TALEN; Bacterial Resistance:Spectinomycin 2026-09-01 09:55:59 0
pFUSB4_TGGC
 
Resource Report
Resource Website
RRID:Addgene_48601 RVD sequence: NG NN NN HD Synthetic Spectinomycin PMID:23734242 Plasmid was created using Golden Gate cloning. Vector Backbone:pFUS_B4; Vector Types:Mammalian Expression, TALEN; Bacterial Resistance:Spectinomycin 2026-09-01 09:55:59 0
pTYB1-pLAC-I73S
 
Resource Report
Resource Website
RRID:Addgene_48722 Lacritin Homo sapiens Ampicillin PMID:23640897 Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin Isoleucine 73 to Serine 2026-09-01 09:56:00 0
pUltra-Chili-Luc
 
Resource Report
Resource Website
10+ mentions
RRID:Addgene_48688 Ampicillin PMID:34088832 See Addgene plasmid #24129 for cloning details. Backbone Marker:Malcolm Moore lab; Vector Backbone:pUltra-Chili; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2026-09-01 09:56:00 33
pTYB1-pLAC-V69S
 
Resource Report
Resource Website
RRID:Addgene_48721 Lacritin Homo sapiens Ampicillin PMID:23640897 Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin Valine 69 to Serine 2026-09-01 09:56:00 0
pUltra-Chili
 
Resource Report
Resource Website
10+ mentions
RRID:Addgene_48687 Ampicillin See Addgene plasmid #24129 for cloning details. Backbone Marker:Malcolm Moore lab; Backbone Size:8300; Vector Backbone:pUltra; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2026-09-01 09:56:00 19
pTYB1-pLAC-N71
 
Resource Report
Resource Website
RRID:Addgene_48720 Lacritin Homo sapiens Ampicillin PMID:23640897 Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. Lacritin protein sequence in this plasmid is: SILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin Deleted first 71 amino acids of mature lacritin without signal peptide 2026-09-01 09:56:00 0
AmCyan-P2A-Xerry
 
Resource Report
Resource Website
RRID:Addgene_48686 AmCyan Synthetic Kanamycin the nAmCyan and the mCherry genes are separated by a P2A sequence that results in 2 separate proteins. It also includes BsmBI restriction sites flanking the nAmCyan gene which result in BsiWI and BssHII overhangs for cloning in-frame with P2A-mCherry. Backbone Marker:clontech; Backbone Size:4000; Vector Backbone:pmR-mCherry; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin SV40 NLS 2026-09-01 09:56:00 0
pFUSB4_TGTC
 
Resource Report
Resource Website
RRID:Addgene_48605 RVD sequence: NG NN NG HD Synthetic Spectinomycin PMID:23734242 Plasmid was created using Golden Gate cloning. Vector Backbone:pFUS_B4; Vector Types:Mammalian Expression, TALEN; Bacterial Resistance:Spectinomycin 2026-09-01 09:55:59 0
pFUSB4_TGTA
 
Resource Report
Resource Website
RRID:Addgene_48604 RVD sequence: NG NN NG NI Synthetic Spectinomycin PMID:23734242 Plasmid was created using Golden Gate cloning. Vector Backbone:pFUS_B4; Vector Types:Mammalian Expression, TALEN; Bacterial Resistance:Spectinomycin 2026-09-01 09:55:59 0
pTYB-pLAC-L108S
 
Resource Report
Resource Website
RRID:Addgene_48725 Lacritin Homo sapiens Ampicillin PMID:23640897 Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin Leucine 108 to Serine 2026-09-01 09:56:00 0
pFUSB4_TGGG
 
Resource Report
Resource Website
RRID:Addgene_48602 RVD sequence: NG NN NN NN Synthetic Spectinomycin PMID:23734242 Plasmid was created using Golden Gate cloning. Vector Backbone:pFUS_B4; Vector Types:Mammalian Expression, TALEN; Bacterial Resistance:Spectinomycin 2026-09-01 09:55:59 0
Nanog-2A-mCherry
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_48680 Nanog Mus musculus Ampicillin PMID:23992847 Vector Backbone:pCR2.1TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin 2026-09-01 09:56:00 1
pLZL2372
 
Resource Report
Resource Website
RRID:Addgene_48683 HIV Integrase Kanamycin PMID:23691126 The depositing lab recommends bacteria strain Rosetta (DE3)pLysS for protein expression. Please contact [email protected] for additional information about this plasmid. Vector Backbone:pET29a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-09-01 09:56:00 0
pLZL2386
 
Resource Report
Resource Website
RRID:Addgene_48682 PFV Integrase Kanamycin PMID:23691126 The depositing lab recommends bacteria strain Rosetta (DE3)pLysS for protein expression. Please contact [email protected] for additional information about this plasmid. Vector Backbone:pET29a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-09-01 09:56:00 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.