Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pTYB1-pLAC-N45 Resource Report Resource Website |
RRID:Addgene_48718 | Lacritin | Homo sapiens | Ampicillin | PMID:23640897 | Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. Lacritin protein sequence in this plasmid is: AAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA | Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | Deleted first 45 amino acids of mature lacritin without signal peptide | 2026-09-01 09:56:00 | 0 |
|
M-tdTom-SP Resource Report Resource Website 1+ mentions |
RRID:Addgene_48677 | TAL binding site w/ GTCCCCTCCACCCCACAGTG protospacer, SP-PAM, and tdTomato reporter. Compatible with S. pyogenes Cas9 | Synthetic | Bleocin (Zeocin) | PMID:24076762 | Vector Backbone:Unknown; Vector Types:CRISPR; Bacterial Resistance:Bleocin (Zeocin) | 2026-09-01 09:56:00 | 2 | ||
|
M-NMn-VP64 Resource Report Resource Website 1+ mentions |
RRID:Addgene_48676 | Cas9-VP64, nuclease-null | N. meningitidis | Ampicillin | PMID:24076762 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | nuclease-null | 2026-09-01 09:56:00 | 5 | |
|
M-NMcas Resource Report Resource Website 1+ mentions |
RRID:Addgene_48670 | Cas9 | N. meningitidis | Ampicillin | PMID:24076762 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 hygro; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | 2026-09-01 09:56:00 | 2 | ||
|
M-SPn-VP64 Resource Report Resource Website 1+ mentions |
RRID:Addgene_48674 | Cas9-VP64, nuclease-null | S. pyogenes | Ampicillin | PMID:24076762 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | nuclease-null | 2026-09-01 09:56:00 | 6 | |
|
M-ST1-sgRNA Resource Report Resource Website 1+ mentions |
RRID:Addgene_48672 | sgRNA targeting GTCCCCTCCACCCCACAGTG, compatible with S. thermophilus #1 Cas9, hU6 promoter | Synthetic | Kanamycin | PMID:24076762 | Backbone Marker:Invitrogen; Vector Backbone:pCR-BluntII-TOPO; Vector Types:CRISPR; Bacterial Resistance:Kanamycin | 2026-09-01 09:56:00 | 4 | ||
|
CBIG-RORb Resource Report Resource Website 1+ mentions |
RRID:Addgene_48709 | RORb | Mus musculus | Ampicillin | Please note that Addgene's sequencing results identified a few differences in the vector backbone when compared to the full plasmid sequence from the depositing laboratory. According to the depositor, these differences are not a concern for the function of the plasmid. | Vector Backbone:CBIG; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | 2026-09-01 09:56:00 | 1 | ||
|
SK-YFP-TD-A Resource Report Resource Website |
RRID:Addgene_48666 | TD prototspacer A/PAM with reporter EYFP | Synthetic | Kanamycin | PMID:24076762 | Vector Backbone:pSC101-kan; Vector Types:CRISPR; Bacterial Resistance:Kanamycin | 2026-09-01 09:56:00 | 0 | ||
|
SK-YFP-NM-A Resource Report Resource Website |
RRID:Addgene_48664 | NM prototspacer A/PAM with reporter EYFP | Synthetic | Kanamycin | PMID:24076762 | Vector Backbone:pSC101-kan; Vector Types:CRISPR; Bacterial Resistance:Kanamycin | 2026-09-01 09:56:00 | 0 | ||
|
M-ST1cas Resource Report Resource Website 1+ mentions |
RRID:Addgene_48669 | Cas9 | S. thermophilus #1 | Ampicillin | PMID:24076762 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.3 TOPO; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | 2026-09-01 09:56:00 | 7 | ||
|
SK-YFP-TD-B Resource Report Resource Website |
RRID:Addgene_48663 | TD prototspacer B/PAM with reporter EYFP | Synthetic | Kanamycin | PMID:24076762 | Vector Backbone:pSC101-kan; Vector Types:CRISPR; Bacterial Resistance:Kanamycin | 2026-09-01 09:56:00 | 0 | ||
|
SK-YFP-SPNM-B Resource Report Resource Website |
RRID:Addgene_48661 | SP/NM prototspacer B/PAM with reporter EYFP | Synthetic | Kanamycin | PMID:24076762 | Vector Backbone:pSC101-kan; Vector Types:CRISPR; Bacterial Resistance:Kanamycin | 2026-09-01 09:56:00 | 0 | ||
|
PM-TD!TB Resource Report Resource Website |
RRID:Addgene_48656 | Bacterial TD crRNA to prototspacer B | Synthetic | Chloramphenicol | PMID:24076762 | Vector Backbone:p15A-cat; Vector Types:CRISPR; Bacterial Resistance:Chloramphenicol | 2026-09-01 09:55:59 | 0 | ||
|
PM-TD!TA Resource Report Resource Website |
RRID:Addgene_48655 | Bacterial TD crRNA to prototspacer A | Synthetic | Chloramphenicol | PMID:24076762 | Vector Backbone:p15A-cat; Vector Types:CRISPR; Bacterial Resistance:Chloramphenicol | 2026-09-01 09:55:59 | 0 | ||
|
PM-ST1!TB Resource Report Resource Website |
RRID:Addgene_48654 | Bacterial ST1 crRNA to prototspacer B | Synthetic | Chloramphenicol | PMID:24076762 | Vector Backbone:p15A-cat; Vector Types:CRISPR; Bacterial Resistance:Chloramphenicol | 2026-09-01 09:55:59 | 0 | ||
|
DS-ST1casN- Resource Report Resource Website 1+ mentions |
RRID:Addgene_48659 | Cas9, nuclease-null | S. thermophilus #1 | Spectinomycin | PMID:24076762 | Vector Backbone:cloDF13-aadA; Vector Types:CRISPR; Bacterial Resistance:Spectinomycin | D to A, DH to AA, N to A | 2026-09-01 09:55:59 | 3 | |
|
DS-SPcas Resource Report Resource Website 10+ mentions |
RRID:Addgene_48645 | Cas9 | S. pyogenes | Spectinomycin | PMID:24076762 | Vector Backbone:cloDF13-aadA; Vector Types:CRISPR; Bacterial Resistance:Spectinomycin | 2026-09-01 09:55:59 | 11 | ||
|
PM-SP!TA Resource Report Resource Website |
RRID:Addgene_48649 | Bacterial SP crRNA to prototspacer A | Synthetic | Chloramphenicol | PMID:24076762 | Vector Backbone:p15A-cat; Vector Types:CRISPR; Bacterial Resistance:Chloramphenicol | 2026-09-01 09:55:59 | 0 | ||
|
pPB-CAG-3xFLAG-empty-pgk-hph Resource Report Resource Website 1+ mentions |
RRID:Addgene_48754 | Ampicillin | PMID:23582324 | Plasmid map is theoretical and may not represent actual sequence. The presence of important plasmid features have been verified by sequencing. | Vector Backbone:Bluescript; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | 2026-09-01 09:56:01 | 3 | |||
|
pPB-CAG-empty-pgk-hph Resource Report Resource Website 1+ mentions |
RRID:Addgene_48753 | Ampicillin | PMID:23582324 | Plasmid map is theoretical and may not represent actual sequence. The presence of important plasmid features have been verified by sequencing. | Vector Backbone:Bluescript; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | 2026-09-01 09:56:01 | 4 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
