Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
MBP-3C-hNorrin(33-133)-monomeric(C93A/C95A/C131A)-1D4_pAcGP67a Resource Report Resource Website |
RRID:Addgene_216385 | Norrin | Homo sapiens | Ampicillin | Please visit https://doi.org/10.1101/2024.02.03.578714 for bioRxiv preprint. | Backbone Marker:BD Biosciences; Vector Backbone:pAcGP67a; Vector Types:Insect Expression, Baculovirus; Bacterial Resistance:Ampicillin | C93A/C95A/C131A | 2026-08-29 01:20:48 | 0 | |
|
MBP-3C-hNorrin(33-133)-1D4_pAcGP67a Resource Report Resource Website 1+ mentions |
RRID:Addgene_216384 | Norrin | Homo sapiens | Ampicillin | Please visit https://doi.org/10.1101/2024.02.03.578714 for bioRxiv preprint. | Backbone Marker:BD Biosciences; Vector Backbone:pAcGP67a; Vector Types:Insect Expression, Baculovirus; Bacterial Resistance:Ampicillin | 2026-08-29 01:20:54 | 1 | ||
|
pENTR-GFP-WT1 +KTS C terminal HA Resource Report Resource Website |
RRID:Addgene_217640 | WT1 +KTS isoform | Homo sapiens | Kanamycin | PMID:33882316 | Vector Backbone:pENTR; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin | 2026-08-29 01:20:49 | 0 | ||
|
pBABE 3xHA-MKK6-EE puro Resource Report Resource Website |
RRID:Addgene_216791 | MKK6 | Homo sapiens | Ampicillin | PMID:39536108 | This plasmid was created by PCR cloning pGEX-4T-1 3xHA-MKK6-EE (Addgene #47579) using BglII (5') and SalI (3') and inserting into pBABE puro that had been digested by BamHI (5') and SalI (3') | Vector Backbone:pBABE puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | S207E and T211E, constitutively active | 2026-08-29 01:20:55 | 0 |
|
pENTR-GFP-WT1 -KTS N terminal HA Resource Report Resource Website |
RRID:Addgene_217641 | WT1 -KTS isoform | Homo sapiens | Kanamycin | PMID:33882316 | Vector Backbone:pENTR; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin | p.408_410delKTS | 2026-08-29 01:20:49 | 0 | |
|
pCW57.1 Ex8 mut WT1 Resource Report Resource Website |
RRID:Addgene_217645 | WT1 | Homo sapiens | Ampicillin | PMID:33882316 | Backbone Marker:Addgene #41393; Vector Backbone:pCW57.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Frameshift exon 8 | 2026-08-29 01:20:56 | 0 | |
|
miniCMV-tdTomato-tDeg Resource Report Resource Website |
RRID:Addgene_217521 | tdTomato-tDeg fluorogenic protein | Homo sapiens | Ampicillin | PMID:38296979 | Backbone Size:1581; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-29 01:20:56 | 0 | ||
|
pENTR-GFP-WT1 -KTS C terminal HA Resource Report Resource Website |
RRID:Addgene_217642 | WT1 -KTS isoform | Homo sapiens | Kanamycin | PMID:33882316 | Vector Backbone:pENTR; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin | p.408_410delKTS | 2026-08-29 01:20:56 | 0 | |
|
TCF4 - P381L in pENTR Resource Report Resource Website |
RRID:Addgene_216570 | TCF4 | Homo sapiens | Kanamycin | insert contains a Kozak sequence that encodes a linker for cloning into N-terminal tagging pDEST vectors | Backbone Marker:GenScript; Backbone Size:2800; Vector Backbone:pCR8-GW-TOPO; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin | P381L | 2026-08-29 01:20:55 | 0 | |
|
AAVS1_Cas9-hGem_gRNA2 Resource Report Resource Website |
RRID:Addgene_217659 | sgRNA2 targeting the human AAVS1 safe harbour locus | Homo sapiens | Ampicillin | PMID:37357575 | Backbone Size:9643; Vector Backbone:pX330-U6-Chimeric_BB-CBh-hSpCas9-hGem-Bpil-P2A-mCherry; Vector Types:Mammalian Expression, Bacterial Expression, CRISPR; Bacterial Resistance:Ampicillin | 2026-08-29 01:20:49 | 0 | ||
|
LEGO-pDHS-AP1x6-DUSP5 Resource Report Resource Website |
RRID:Addgene_217418 | Luciferase, GFP | Homo sapiens | Ampicillin | This is an inducible lentiviral luciferase expression vector that has 6 RAS/MAPK-inducible AP-1 sites driving transcription from the human DUSP5 promoter, which is highly active in most acute myeloid leukaemia samples but not in normal myeloid stem cells (Assi et al, 2019). This is a CG island promoter containing Sp1, SRF, ETS and NF-kB sites, and is likely to be activated by signalling downstream of FLT3-ITD mutations (Assi et al, 2019). This vector also contains a myeloid cell chromatin priming element from the human IL3 gene that can potentially diminish chromatin silencing effects by maintaining open chromatin. LEGO-pDHS-AP1x6-DUSP5 was constructed from LEGO-pDHS-AP1x6-GM55 by replacing the minimal human CSF2 promoter with the full-length human DUSP5 promoter. The pDHS was added by inserting into the XbaI site a 274 bp PCR-generated fragment of a DNA segment located 10 kb upstream of the human IL3 gene that maintains open chromatin in myeloid cells. LEGO-AP1x6-GM55 was previously constructed from LeGO-iG (Weber et al, 2008) (Addgene #27358) by replacing a NotI/XbaI fragment containing the U6 and SFFV promoters with a fragment from the plasmid pAP1-3 (Addgene #71258) that has 3 copies of the MMP3 gene AP-1 site in front of human CSF2 -55 to +28 minimal promoter driving expression of the Luc+ firefly luciferase gene originating from the plasmid pGL3 (Promega), and then duplicating the array of 3 AP-1 sites. The luciferase gene is linked to an IRES that in principle supports co-expression of luciferase and EGFP. The insert has 2 copies of the SV40 transcription termination/polyadenylation signal upstream of the multiple cloning site, which blocks background read-through transcription originating in the vector backbone, which itself can be substantial (Bert et al, 2000). The inserted luciferase gene and SV40 polyA site sequences originate from the plasmid pXPG (Bert et al, 2000) (Addgene #71248). The priming element (pDHS) encompasses RUNX1 and ETS1 binding sites and resembles sites that prime genes for rapid activation in T cells (Bevington et al, 2016). References: Assi et al. Nat Genet. 2019; 51:151-162. PMID 30420649. Bert et al. Plasmid. 2000 Sep;44(2):173-82. PMID 10964627. Weber et al. Mol Ther. 2008 Apr. 16(4):698-706. PMID 18362927. Bevington et al. Bioessays 2016 Dec 27. doi: 10.1002/bies.201600184. PMID 28026028. | Backbone Marker:Boris Fehse (Addgene #27358); Vector Backbone:LeGO-iG; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin | 2026-08-29 01:20:49 | 0 | ||
|
FP5369 KIF17MD-flag- FIREmate Resource Report Resource Website |
RRID:Addgene_216724 | KIF17 | Homo sapiens | Kanamycin | PMID:37640938 | Vector Backbone:pEGFP-N3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 1-547 | 2026-08-29 01:20:48 | 0 | |
|
LEGO-pDHS-AP1x6-GM55 Resource Report Resource Website |
RRID:Addgene_217416 | Luciferase, GFP | Homo sapiens | Ampicillin | This is an inducible lentiviral luciferase expression vector that has 6 RAS/MAPK-inducible AP-1 sites driving transcription from the minimal CSF2 promoter, plus a chromatin priming element from the IL3 gene that can potentially diminish chromatin silencing effects. LEGO-pDHS-AP1x6-GM55 was constructed from LEGO-AP1x6-GM55 by inserting into the XbaI site a 274 bp PCR-generated fragment of a DNA segment located 10 kb upstream of the human IL3 gene that maintains open chromatin at a constitutive DNaseI Hypersensitive Site in myeloid cells. LEGO-AP1x6-GM55 was constructed from LeGO-iG (Weber et al, 2008) (Addgene #27358) by replacing a NotI/XbaI fragment containing the U6 and SFFV promoters with a fragment from the plasmid pAP1-3 (Addgene #71258) that has 3 copies of the MMP3 gene AP-1 site in front of human CSF2 -55 to +28 minimal promoter driving expression of the Luc+ firefly luciferase gene originating from the plasmid pGL3 (Promega), and then duplicating the array of 3 AP-1 sites. The luciferase gene is linked to an IRES that in principle supports co-expression of luciferase and EGFP. The insert has 2 copies of the SV40 transcription termination/polyadenylation signal upstream of the multiple cloning site, which blocks background read-through transcription originating in the vector backbone, which itself can be substantial (Bert et al, 2000). The inserted luciferase gene and SV40 polyA site sequences originate from the plasmid pXPG (Bert et al, 2000) (Addgene #71248). The priming element (pDHS) encompasses RUNX1 and ETS1 binding sites and resembles sites that prime genes for rapid activation in T cells (Bevington et al, 2016). References: Bert et al. Plasmid. 2000 Sep;44(2):173-82. PMID 10964627. Weber et al. Mol Ther. 2008 Apr. 16(4):698-706. PMID 18362927. Bevington et al. Bioessays 2016 Dec 27. doi: 10.1002/bies.201600184. PMID 28026028. | Backbone Marker:Boris Fehse (Addgene #27358); Vector Backbone:LeGO-iG; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin | 2026-08-29 01:20:55 | 0 | ||
|
LEGO-pDHS-ITDE-AP1x6-DUSP5 Resource Report Resource Website |
RRID:Addgene_217419 | Luciferase, GFP | Homo sapiens | Ampicillin | This expression vector contains a synthetic enhancer that was designed as an array of transcription factor binding sites predicted to be highly active in acute myeloid leukaemia cells carrying activating mutations in the receptor FLT3 (Assi et al., 2019). This putative enhancer was generated as an oligonucleotide duplex containing binding sites for EGR1, ETS, SRF, CREB, NF1, NF-kB and WT1, inserted into LEGO-pDHS-AP1x6-DUSP5. The closely linked ETS, SRF, and CREB sites are derived from a Serum Response Element in the FOS promoter which is induced by MAPK. LEGO-pDHS-AP1x6-DUSP5 is an inducible lentiviral luciferase expression vector that can has 6 RAS/MAPK-inducible AP-1 sites driving transcription from the human DUSP5 promoter, which is highly active in most acute myeloid leukaemia samples but not in normal myeloid stem cells (Assi et al, 2019). This is a CG island promoter containing Sp1, SRF, ETS and NF-kB sites, and is likely to be activated by signalling downstream of FLT3-ITD mutations (Assi et al, 2019). This vector also contains a myeloid cell chromatin priming element from the human IL3 gene that can potentially diminish chromatin silencing effects by maintaining open chromatin. LEGO-pDHS-AP1x6-DUSP5 was constructed from LEGO-pDHS-AP1x6-GM55 by replacing the minimal human CSF2 promoter with the full-length human DUSP5 promoter. The pDHS was added by inserting into the XbaI site a 274 bp PCR-generated fragment of a DNA segment located 10 kb upstream of the human IL3 gene that maintains open chromatin in myeloid cells. LEGO-AP1x6-GM55 was previously constructed from LeGO-iG (Weber et al, 2008) (Addgene #27358) by replacing a NotI/XbaI fragment containing the U6 and SFFV promoters with a fragment from the plasmid pAP1-3 (Addgene #71258) that has 3 copies of the MMP3 gene AP-1 site in front of human CSF2 -55 to +28 minimal promoter driving expression of the Luc+ firefly luciferase gene originating from the plasmid pGL3 (Promega), and then duplicating the array of 3 AP-1 sites. The luciferase gene is linked to an IRES that in principle supports co-expression of luciferase and EGFP. The insert has 2 copies of the SV40 transcription termination/polyadenylation signal upstream of the multiple cloning site, which blocks background read-through transcription originating in the vector backbone, which itself can be substantial (Bert et al, 2000). The inserted luciferase gene and SV40 polyA site sequences originate from the plasmid pXPG (Bert et al, 2000) (Addgene #71248). The priming element (pDHS) encompasses RUNX1 and ETS1 binding sites and resembles sites that prime genes for rapid activation in T cells (Bevington et al, 2016)). References: Assi et al. Nat Genet. 2019; 51:151-162. PMID 30420649. Bert et al. Plasmid. 2000 Sep;44(2):173-82. PMID 10964627. Weber et al. Mol Ther. 2008 Apr. 16(4):698-706. PMID 18362927. Bevington et al. Bioessays 2016 Dec 27. doi: 10.1002/bies.201600184. PMID 28026028. | Backbone Marker:Boris Fehse (Addgene #27358); Vector Backbone:LeGO-iG; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin | 2026-08-29 01:20:49 | 0 | ||
|
pFastBac dual_Human full length CDK7(W132R, S164D, T170E) Resource Report Resource Website |
RRID:Addgene_217013 | CDK7(W132R, S164D, T170E) | Homo sapiens | Ampicillin and Gentamicin | PMID:38870939 | Vector Backbone:pFastBac dual; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin and Gentamicin | CDK7(W132R, S164D, T170E) | 2026-08-29 01:20:49 | 0 | |
|
PE-SUMO CRYAB Resource Report Resource Website |
RRID:Addgene_217670 | CRYAB | Homo sapiens | Ampicillin | PMID:39368693 | Expressed in a soluble state, except when grown in minimal media to produce 15N labeled protein. Can be purified using N-terminal 6xHis tag and SUMO tag can then be efficiently removed by ULP-1 cleavage yielding the N-terminal methionine. | Backbone Marker:LifeSensors; Backbone Size:5761; Vector Backbone:PE-SUMO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 01:20:49 | 0 | |
|
Hygro-P2A-HA-FKBP-WAPL Resource Report Resource Website |
RRID:Addgene_217666 | WapI | Homo sapiens | Ampicillin and Kanamycin | PMID:37357575 | Backbone Size:3913; Vector Backbone:pCR2.1; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Ampicillin and Kanamycin | 2026-08-29 01:20:49 | 0 | ||
|
STXBP1 in pENTR Resource Report Resource Website |
RRID:Addgene_216624 | STXBP1 | Homo sapiens | Spectinomycin | insert contains a Kozak sequence that encodes a linker for cloning into N-terminal tagging pDEST vectors | Backbone Marker:GenScript; Backbone Size:2800; Vector Backbone:pCR8-GW-TOPO; Vector Types:Gateway Cloning; Bacterial Resistance:Spectinomycin | 2026-08-29 01:20:48 | 0 | ||
|
pAAV-hSyn-frt-DIO-hM4D(Gi)-mCherry Resource Report Resource Website 1+ mentions |
RRID:Addgene_217398 | hM4D(Gi)-mCherry | Homo sapiens | Ampicillin | Backbone Size:4923; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin | 2026-08-29 01:20:49 | 1 | |||
|
SUMO CRYGS 16-177 Q16C Resource Report Resource Website |
RRID:Addgene_217673 | CRYGS | Homo sapiens | Kanamycin | This a N-terminally truncated gamma S crystallin missing its N-terminal 15 amino acid residues and containing a Q16C mutation at its N-terminus to act as a site to perform native chemical ligation. It also has a N-terminal SUMO tag with a 6X His tag with the amino acid sequence: GHHHHHHGSLQDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQ IGG It will express in a soluble state with the SUMO tag, but will precipitate once the SUMO tag is removed during ulp-1 cleavage. It has a propensity to form non-disulfide linked multimers once the SUMO tag is removed, so the ligation reaction must be performed immediately after ULP-1 treatment. | Backbone Size:5368; Vector Backbone:pET28B+; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Glutamine 16 changed to Cysteine, and amino acids 1-15 removed from gamma S crystallin | 2026-08-29 01:20:49 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
