Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Organism:synthetic (facet)


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

30,615 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
pET-22b(+)_PelB-BN00AZ-W-FLAG-His
 
Resource Report
Resource Website
RRID:Addgene_218039 BN00AZ-W Synthetic Ampicillin PMID:38878854 Amino Acid Sequence of Insert: QWQFVESGGGSVQAGASLRLSCAASGLSFSLYAMGWFRQAPGKEREFVAAILRSPSSAYYTESVKGRFTISRDNAKNTVYLQMSSLKPEDTAVYYCAARRTDDVVRGYDFRNYNYRSQGTRVTVSS. Vector Backbone:pET-22b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 01:10:41 0
pET-22b(+)_PelB-BN00P4-4-FLAG-His
 
Resource Report
Resource Website
RRID:Addgene_218051 BN00P4-4 Synthetic Ampicillin PMID:38878854 Amino Acid Sequence of Insert: SRRAEVQLLESGGGLVQPGGSLRLSCAASGFRDSDEDMGWVRQAPGKGLEWVSSINNDDGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASVNDDNWGFDYWGQGTLVTVSS. Vector Backbone:pET-22b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 01:10:41 0
pET-22b(+)_PelB-BN00A2-0-FLAG-His
 
Resource Report
Resource Website
RRID:Addgene_218053 BN00A2-0 Synthetic Ampicillin PMID:38878854 Amino Acid Sequence of Insert: SRRAEVQLLESGGGLVQPGGSLRLSCAASGFRDSDEDMGWVRQAPGKGLEWVSSIESGDGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASGWSWGSHFDYWGQGTLVTVSS. Vector Backbone:pET-22b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 01:10:41 0
T40A+Q54A
 
Resource Report
Resource Website
RRID:Addgene_217913 PXP T40A+Q54A Synthetic Ampicillin PMID:38477407 Backbone Size:4667; Vector Backbone:pQE-30; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin Threonine at position 41 and 253 mutated to Alanine, Glutamine at position 55 and 267 mutated to Alanine, changes occur in each of the two coils in order to alter the coiled-coil interaction 2026-09-05 01:10:41 0
pET-22b(+)_PelB-BN009F-9-FLAG-His
 
Resource Report
Resource Website
RRID:Addgene_218048 BN009F-9 Synthetic Ampicillin PMID:38878854 Amino Acid Sequence of Insert: SRRAEVQLLESGGGLVQPGGSLRLSCAASGFRDSDEDMGWVRQAPGKGLEWVSSIYYPNGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASLNDSVGYFDYWGQGTLVTVSS. Vector Backbone:pET-22b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 01:10:41 0
pET-22b(+)_PelB-BN00NH-H-FLAG-His
 
Resource Report
Resource Website
RRID:Addgene_218046 BN00NH-H Synthetic Ampicillin PMID:38878854 Amino Acid Sequence of Insert: SRRAEVQLLESGGGLVQPGGSLRLSCAASGFRDSDEDMGWVRQAPGKGLEWVSSIDNNDGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASQVWSDYDFDYWGQGTLVTVSS. Vector Backbone:pET-22b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 01:10:41 0
pET-22b(+)_PelB-BN009K-H-FLAG-His
 
Resource Report
Resource Website
RRID:Addgene_218049 BN009K-H Synthetic Ampicillin PMID:38878854 Amino Acid Sequence of Insert: SRRAEVQLLESGGGLVQPGGSLRLSCAASGFRDSDEDMGWVRQAPGKGLEWVSSISAYSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASNWYYNTVFDYWGQGTLVTVSS. Vector Backbone:pET-22b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 01:10:41 0
pBXNPFLAGH_BN001T-N
 
Resource Report
Resource Website
RRID:Addgene_218077 BN001T-N Synthetic Ampicillin PMID:38878854 Amino Acid Sequence of Insert: QWQLVESGGGLVQAGGSLRLSCAASGQTFSMYRMGWFRQAPGKERDFVADISWSGATKFYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAVPKRPGGEYAAWSKGTPVTVSS. Vector Backbone:pBXNPFLAGH; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 01:10:41 0
pK6-K7
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_218223 linker sequence Synthetic Spectinomycin Backbone Marker:Addgene #47998; Vector Backbone:pICH41308; Vector Types:CRISPR; Bacterial Resistance:Spectinomycin 2026-09-05 01:10:42 1
pK8-J11
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_218227 linker sequence Synthetic Spectinomycin Backbone Marker:Addgene #47998; Vector Backbone:pICH41308; Vector Types:CRISPR; Bacterial Resistance:Spectinomycin 2026-09-05 01:10:42 1
pK6-J11
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_218226 linker sequence Synthetic Spectinomycin Backbone Marker:Addgene #47998; Vector Backbone:pICH41308; Vector Types:CRISPR; Bacterial Resistance:Spectinomycin 2026-09-05 01:10:42 1
pBXNPFLAGH_BN0059-C
 
Resource Report
Resource Website
RRID:Addgene_218083 BN0059-C Synthetic Ampicillin PMID:38878854 Amino Acid Sequence of Insert: QGQLVESGGGLVQAGGSLRLSCAASGRTFSSYAMAWFRQAPGKEREFVGAISRSGSTYYRDSVMGRFTISRDNSKNTVYLQMNSLKPEDTAIYYCAAARTRALESAYIPRDFDSWSQGTPVTVSS. Vector Backbone:pBXNPFLAGH; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 01:10:42 0
pBXNPFLAGH_BN001K-M
 
Resource Report
Resource Website
RRID:Addgene_218084 BN001K-M Synthetic Ampicillin PMID:38878854 Amino Acid Sequence of Insert: QVQLVESGGGLVQAGGSLRLSCAASGRTLNSSGMGWFRQAPGKERELVAAISWLGSSTYYKDSVKGRFTISRDYAKNTLYLQMNSLKPEDTAVYYCAACLRSYYSGSYCSRADDYNYWGKGTPVTVSS. Vector Backbone:pBXNPFLAGH; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 01:10:42 0
pBXNPFLAGH_BN008H-P
 
Resource Report
Resource Website
RRID:Addgene_218081 BN008H-P Synthetic Ampicillin PMID:38878854 Amino Acid Sequence of Insert: QVQLVESGGGLVQAGGSLRLSCAASGFPVAYKFMYWYRQAPGKEREWVAAIESQGSFTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCHVYVGMEYWGQGTQVTVSS. Vector Backbone:pBXNPFLAGH; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 01:10:41 0
pBXNPFLAGH_BN004M-4
 
Resource Report
Resource Website
RRID:Addgene_218082 BN004M-4 Synthetic Ampicillin PMID:38878854 Amino Acid Sequence of Insert: QLQLVESGGGSVQAGGSLRLSCAASGRTFSSYAVGWFRQAPGKERESVAVIARSAFGTYYLDSVKGRFTISRENAENTVYLQMNSLRPEDTAVYYCAAGTNGRYSGGSFSWVGDAYWSQGTRVTVSS. Vector Backbone:pBXNPFLAGH; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-09-05 01:10:42 0
pIRHD-TetR-GAL80-Rho1-GAL4
 
Resource Report
Resource Website
RRID:Addgene_218274 gal80Arm1-pAgTEF1>KanMX4>tAgTEF1-pHAC1>UBI4>>DHFRP66L-TetR>NLS>TUP1>tABF1-pTEF2>Rho1C17R>>GAL4>tGAL4-pTEF1(TetO)>GAL80Arm2 Synthetic Ampicillin PMID:38808673 Vector Backbone:pUC19; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin DHFR (P66L), Rho1 (C17R) 2026-09-05 01:10:42 0
pIRGAL3C
 
Resource Report
Resource Website
RRID:Addgene_218275 fcy1(207-356)-pAgTEF1>ble>tAgTEF1-pENO2>GAL3C(S509P)>tENO2-fcy1(454-778) Synthetic Ampicillin PMID:38808673 Vector Backbone:pUC19; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin GAL3 (S509P) 2026-09-05 01:10:42 0
pJE13HD7
 
Resource Report
Resource Website
RRID:Addgene_218281 HO(-253, -1)-Repeat1-ISceI-pAgTEF1>Hph(partial) Synthetic Ampicillin Please visit https://doi.org/10.1101/2024.01.30.578080 for bioRxiv preprint. Vector Backbone:pUC19; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin 2026-09-05 01:10:42 0
pToxAmp1
 
Resource Report
Resource Website
RRID:Addgene_218285 HO(-253, -1)-pRPL8B>RelB>tPDC1-pTEF1>yEGFP>tURA3-ARS712-HO(-731, -264) Synthetic Ampicillin Please visit https://doi.org/10.1101/2024.01.30.578080 for bioRxiv preprint. Vector Backbone:pUC19; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin 2026-09-05 01:10:42 0
pToxamEXP4CUP1
 
Resource Report
Resource Website
RRID:Addgene_218284 Hph>tAgTEF1-ISceI-Repeat2-pCUP1>RelE(1-125)>RPL28intron>RelE(126, 289)>tTPI1-HO(1828, 1979) Synthetic Ampicillin Please visit https://doi.org/10.1101/2024.01.30.578080 for bioRxiv preprint. Vector Backbone:pUC19; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin 2026-09-05 01:10:42 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.