Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Genetic Insert: dCas13b-GGS-NYTHDF2(100-200)
Vector Backbone Description: Vector Backbone:cmv d0; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30183280
Proper citation: RRID:Addgene_119856 Copy
Genetic Insert: dCas13b-GGS-NYTHDF1(100-200)
Vector Backbone Description: Vector Backbone:cmv d0; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30183280
Proper citation: RRID:Addgene_119857 Copy
Species: Homo sapiens
Genetic Insert: FBXL19
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag:MHHHHHHSSGRENLYFQG. FBXL19:JMC067-G03:C226959. SGC link: http://www.thesgc.org/structures/6ASB/
Proper citation: RRID:Addgene_119954 Copy
Species: Homo sapiens
Genetic Insert: L3MBTL1
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag:MHHHHHHSSGRENLYFQG. L3MBTL1:APC053-A03:C30586. SGC link: http://www.thesgc.org/structures/6BYB/
Proper citation: RRID:Addgene_119957 Copy
Species: Homo sapiens
Genetic Insert: DOT1L
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #79526); Vector Backbone:pET28-MKH8SUMO; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag: MKKHHHHHHHHSSGLVPRGSMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGTENLYFQG. DOT1L:JMC107-B04:C239899. SGC link: http://www.thesgc.org/structures/6CKO/
Proper citation: RRID:Addgene_119962 Copy
Species: Homo sapiens
Genetic Insert: GID4
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #79526); Vector Backbone:pET28-MKH8SUMO; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag:MKKHHHHHHHHSSGLVPRGSMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGTENLYFQG. GID4:JMC130-A03:C240642. SGC link: http://www.thesgc.org/structures/6CCR/
Proper citation: RRID:Addgene_119960 Copy
Species: Homo sapiens
Genetic Insert: GID4
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag:MHHHHHHSSGRENLYFQG. GID4:JMC130-A04:C240838.
SGC links:
https://www.thesgc.org/structures/6CDG/
https://www.thesgc.org/structures/6WZZ/
https://www.thesgc.org/structures/7S12/
https://www.thesgc.org/structures/7SLZ/
Proper citation: RRID:Addgene_119961 Copy
Species: Homo sapiens
Genetic Insert: LOC149281
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #79526); Vector Backbone:pET28-MKH8SUMO; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag: MKKHHHHHHHHSSGLVPRGSMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGTENLYFQG. LOC149281:JMC119-E02:C237152. SGC link: http://www.thesgc.org/structures/6DUB/
Proper citation: RRID:Addgene_119967 Copy
Species: Homo sapiens
Genetic Insert: MBD3
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26101); Vector Backbone:pET28GST-LIC; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPRGS. MBD3:JMC065-E03:C226116. SGC link: http://www.thesgc.org/structures/6CC8/
https://www.thesgc.org/structures/6CCG/
Proper citation: RRID:Addgene_119959 Copy
Species: Homo sapiens
Genetic Insert: MBD2
Vector Backbone Description: Backbone Marker:SGC (Addgene Plasmid #26096); Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Comments: N-Tag:MHHHHHHSSGRENLYFQG. MBD2:JMC01O-G01:C207125. SGC links: http://www.thesgc.org/structures/6C1A/
http://www.thesgc.org/structures/6C1T/
http://www.thesgc.org/structures/6C1V/
http://www.thesgc.org/structures/6CNP/
Proper citation: RRID:Addgene_119958 Copy
Species: Broad range of bacteria
Genetic Insert: Plasmid assembled from 3 CYANO-VECTOR modular devices: CV-RSF1010Y25F, CV-aph1, CV-PconII-LTRBS-GFPmut2
Vector Backbone Description: Backbone Size:7846; Vector Backbone:RSF1010Y25F_aph1_PconII-GFPmut2; Vector Types:Other; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25074377
Proper citation: RRID:Addgene_120080 Copy
Species: Synechococcus elongatus PCC 7942
Genetic Insert: Plasmid assembled from 3 CYANO-VECTOR modular devices: CV-S7942NS2, CV-aph1, CV-ccdB-SwaI
Vector Backbone Description: Backbone Size:4372; Vector Backbone:S7942NS2_aph1_ccdB-SwaI; Vector Types:Other; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25074377
Proper citation: RRID:Addgene_120082 Copy
Species: Homo sapiens
Genetic Insert: kinesin family member C1
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3955; Vector Backbone:pmCherry-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:31100061
Proper citation: RRID:Addgene_120171 Copy
Species: Homo sapiens
Genetic Insert: VAMP associated protein A
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4721; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:31100061
Proper citation: RRID:Addgene_120175 Copy
Species: Mus musculus
Genetic Insert: kinesin family member 5A
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4727; Vector Backbone:pmCherry-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:31100061
Proper citation: RRID:Addgene_120163 Copy
Species: Mus musculus
Genetic Insert: kinesin family member 1A
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4727; Vector Backbone:pmCherry-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:31100061
Proper citation: RRID:Addgene_120165 Copy
Species: Mus musculus
Genetic Insert: BICD cargo adaptor 2
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4713; Vector Backbone:pmCherry-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:31100061
Proper citation: RRID:Addgene_120168 Copy
Genetic Insert: g17_U6_NOS_NLS_GB1_NLS_linker_VP64_linker_sfGFP_scFv_UBQ10_Insulator_UBQ10_Ω_dCas9_1xHA_3xNLS_linker_10xGCN4_OCS
Vector Backbone Description: Vector Backbone:pEG302; Vector Types:Plant Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30760722
Proper citation: RRID:Addgene_120250 Copy
Genetic Insert: NOS_NLS_GB1_NLS_linker_VP64_linker sfGFP_scFv_UBQ10_Insulator_ UBQ10_Ω dCas9_1xHA_3xNLS_linker_10xGCN4_OCS
Vector Backbone Description: Vector Backbone:pEG302; Vector Types:Plant Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30760722
Proper citation: RRID:Addgene_120251 Copy
Genetic Insert: g4_U6_NOS_NLS_GB1_NLS_linker_VP64_linker_sfGFP_scFv_UBQ10_Insulator_UBQ10_Ω_dCas9_1xHA_3xNLS_linker_10xGCN4_OCS
Vector Backbone Description: Vector Backbone:pEG302; Vector Types:Plant Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30760722
Proper citation: RRID:Addgene_120249 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.