Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Bacterial Resistance:streptomycin (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

228 Results - per page

Show More Columns | Download 228 Result(s)

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pAW184
 
Resource Report
Resource Website 		RRID:Addgene_113176 Cas1 E. coli Streptomycin PMID:28729350 Backbone Size:4000; Vector Backbone:pCDF1b; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin R112A 2026-08-15 01:02:09 0
pAW174
 
Resource Report
Resource Website 		RRID:Addgene_113181 Cas1 E. coli Streptomycin PMID:28729350 Backbone Size:4000; Vector Backbone:pCDF1b; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin R138A 2026-08-15 01:02:09 0
pMVA
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_121149 MVA Pathway (ERG12, ERG8, MVD1, IDI, MvaE, MvaS ) Other Streptomycin PMID:30103600 Vector Backbone:pCDF- Duet-1; Vector Types:Synthetic Biology; Bacterial Resistance:Streptomycin 2026-08-15 01:03:31 1
pSG019
 
Resource Report
Resource Website 		RRID:Addgene_126502 disaggregase ClpG with 6xHis-tag Pseudomonas aeruginosa SG17M Streptomycin PMID:29263094 Backbone Size:6055; Vector Backbone:pJN105; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2026-08-15 01:04:26 0
pOxyR_gfp
 
Resource Report
Resource Website 		RRID:Addgene_194154 transcriptional regulator, OxyR, cognate promoter PoxyS, fluorescent protein sfGFP E. coli Streptomycin PMID:34820092 Backbone Marker:https://seva-plasmids.com/; Backbone Size:2390; Vector Backbone:pSEVA-based; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2026-08-15 01:25:07 0
pOxyR_rfp
 
Resource Report
Resource Website 		RRID:Addgene_194155 transcriptional regulator, OxyR, cognate promoter PoxyS, fluorescent protein mCherry E. coli Streptomycin PMID:34820092 Backbone Marker:https://seva-plasmids.com/; Backbone Size:2754; Vector Backbone:pSEVA-based; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2026-08-15 01:25:07 0
pRoRL
 
Resource Report
Resource Website 		RRID:Addgene_213132 Streptomycin PMID:39126322 Backbone Size:5261; Vector Backbone:CloDF13; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Streptomycin 2026-08-15 01:29:45 0
PCDF Bravo-PotH-OL1del
 
Resource Report
Resource Website 		RRID:Addgene_216749 potH E. coli (Bacteria) Streptomycin PMID:40154612 IPTG inducible Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Outer loop 1 (OL1) with the sequence of [FKISLAEMARAIPPYTELMEWADGQLSITLNLGNFLQLTDDPLYFDAYLQSLQ] is deleted. 2026-08-15 01:29:53 0
PCDF Bravo-PotH-OL2del
 
Resource Report
Resource Website 		RRID:Addgene_216750 potH E. coli (Bacteria) Streptomycin PMID:40154612 IPTG inducible Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Outer loop 2 (OL2) with the sequence of [WMGILKNNGVLNNFLLWLGVIDQPLTILHTN] is deleted. 2026-08-15 01:29:55 0
PCDF Bravo-PotH-OL3/2sub
 
Resource Report
Resource Website 		RRID:Addgene_216752 potH E. coli (Bacteria) Streptomycin PMID:40154612 IPTG inducible Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Outer loop 2 (OL2) with the sequence of [WMGILKNNGVLNNFLLWLGVIDQPLTILHTN] is substituted with OL3 [ELLGGPDSIMIGRVLWQEFFNNRDW]. 2026-08-15 01:29:53 0
PCDF Bravo-PotH-OL3del
 
Resource Report
Resource Website 		RRID:Addgene_216751 potH E. coli (Bacteria) Streptomycin PMID:40154612 IPTG inducible Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Outer loop 3 (OL3) with the sequence of [ELLGGPDSIMIGRVLWQEFFNNRDW] is deleted. 2026-08-15 01:29:53 0
pCDF-cascade
 
Resource Report
Resource Website 		RRID:Addgene_247069 E.coli Type I-E CRISPR cas Escherichia coli K-12 W3110 Streptomycin PMID:41290661 Backbone Marker:N/A; Backbone Size:2300; Vector Backbone:pCDF; Vector Types:Bacterial Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Streptomycin 2026-08-15 01:34:30 0
pCDF_AaRaf1/Raf2/BSD2
 
Resource Report
Resource Website 		RRID:Addgene_229515 Rubisco accumulation factor 1 Anthoceros agrestis Streptomycin PMID:39491367 Removal of Anthoceros agrestis RbcX2 and RbcX1 from pCDF_AaRaf1/Raf2/RbcX2/BSD2/RbcX1 was performed by Genscript. Backbone Marker:Novagen; Backbone Size:3781; Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin N terminus chloroplast transit peptide truncation 2026-08-15 01:33:06 0
pCDF_AtRaf1/Raf2/RbcX2/BSD2/RbcX1
 
Resource Report
Resource Website 		RRID:Addgene_229510 Rubisco accumulation factor 1 Arabidopsis thaliana Streptomycin PMID:39491367 Gene Synthesis from Genscript. Design of the Rubisco assembly factor inserts was mirroring pAtR1/R2/RX/B2 as shown in Aigner et al 2017 (10.1126/science.aap9221), with the addition of RbcX isoform, RbcXI after the BSD2 gene. Backbone Marker:Novagen; Backbone Size:3781; Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin N terminus chloroplast transit peptide truncation 2026-08-15 01:33:06 0
pCDF_AtRaf1/Raf2/BSD2
 
Resource Report
Resource Website 		RRID:Addgene_229511 Rubisco accumulation factor 1 Arabidopsis thaliana Streptomycin PMID:39491367 Gene Synthesis from Genscript. Design of the three Rubisco assembly factor inserts was mirroring pAtR1/R2/RX/B2 as shown in Aigner et al 2017 (10.1126/science.aap9221). Backbone Marker:Novagen; Backbone Size:3781; Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin N terminus chloroplast transit peptide truncation 2026-08-15 01:33:06 0
pCDF_AaRaf1/RbcX2/BSD2/RbcX1
 
Resource Report
Resource Website 		RRID:Addgene_229513 Rubisco accumulation factor 1 Anthoceros agrestis Streptomycin PMID:39491367 Removal of Anthoceros agrestis Raf2 from pCDF_AaRaf1/Raf2/RbcX2/BSD2/RbcX1 was performed by Genscript. Backbone Marker:Novagen; Backbone Size:3781; Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin N terminus chloroplast transit peptide truncation 2026-08-15 01:33:06 0
pCDF_AaRaf1/Raf2/RbcX2/BSD2
 
Resource Report
Resource Website 		RRID:Addgene_229507 Rubisco accumulation factor 1 Anthoceros agrestis Streptomycin PMID:39491367 Fragments of assembly factors , with T7 promoter and terminator, with type II restriction cut sites at both ends were ordered from Twist Bioscience, construct was formed with a golden gate pot reaction to an receiver pCDF backbone. Backbone Marker:Novagen; Backbone Size:3781; Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin N terminus chloroplast transit peptide truncation 2026-08-15 01:33:06 0
pCDF_AaRaf1/Raf2/RbcX2/BSD2/RbcX1
 
Resource Report
Resource Website 		RRID:Addgene_229509 Rubisco accumulation factor 1 Anthoceros agrestis Streptomycin PMID:39491367 Gene Synthesis from Genscript. Each assembly factor is regulated by a individual T7 promoter and terminator. Backbone Marker:Novagen; Backbone Size:3781; Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin N terminus chloroplast transit peptide truncation 2026-08-15 01:33:06 0
pCDF_AaRaf1/Raf2/RbcX1/BSD2
 
Resource Report
Resource Website 		RRID:Addgene_229508 Rubisco accumulation factor 1 Anthoceros agrestis Streptomycin PMID:39491367 Fragments of assembly factors , with T7 promoter and terminator, with type II restriction cut sites at both ends were ordered from Twist Bioscience, construct was formed with a golden gate pot reaction to an receiver pCDF backbone. Backbone Marker:Novagen; Backbone Size:3781; Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin N terminus chloroplast transit peptide truncation 2026-08-15 01:33:06 0
Ec dnaQ-pCDFDuet
 
Resource Report
Resource Website 		RRID:Addgene_241263 dnaQ E. coli Streptomycin Vector Backbone:pCDFDuet; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2026-08-15 01:33:43 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch