Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pcDNA5-FRT-TO-Nsp16-HF Resource Report Resource Website |
RRID:Addgene_157725 | Nsp16-HF | SARS-CoV-2 | Ampicillin | PMID:33313418 | Backbone Marker:Thermo Fisher; Vector Backbone:pcDNA5-FRT-TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | codon optimized | 2026-08-15 01:08:08 | 0 | |
|
pcDNA5-FRT-TO-FH-Nsp16 Resource Report Resource Website |
RRID:Addgene_157724 | FH-Nsp16 | SARS-CoV-2 | Ampicillin | PMID:33313418 | Backbone Marker:Thermo Fisher; Vector Backbone:pcDNA5-FRT-TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | codon optimized | 2026-08-15 01:08:07 | 0 | |
|
pcDNA5-FRT-TO-FH-Nsp15 Resource Report Resource Website |
RRID:Addgene_157721 | FH-Nsp15 | SARS-CoV-2 | Ampicillin | PMID:33313418 | Backbone Marker:Thermo Fisher; Vector Backbone:pcDNA5-FRT-TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | codon optimized | 2026-08-15 01:08:07 | 0 | |
|
pcDNA5-FRT-TO-Nsp15 Resource Report Resource Website |
RRID:Addgene_157720 | Nsp15 | SARS-CoV-2 | Ampicillin | PMID:33313418 | Backbone Marker:Thermo Fisher; Vector Backbone:pcDNA5-FRT-TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | codon optimized | 2026-08-15 01:08:07 | 0 | |
|
pcDNA-FRT-TO-Nprot_GC3opt Resource Report Resource Website |
RRID:Addgene_157730 | Nprot_GC3opt | SARS-CoV-2 | Ampicillin | PMID:33313418 | Backbone Marker:Thermo Fisher; Vector Backbone:pcDNA5-FRT-TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | codon optimized; gene expression was optimized by increasing the GC3 content within codons | 2026-08-15 01:08:08 | 0 | |
|
pcDNA5-FRT-TO-Nprot-HF_GC3opt Resource Report Resource Website |
RRID:Addgene_157732 | Nprot-HF_GC3opt | SARS-CoV-2 | Ampicillin | PMID:33313418 | Backbone Marker:Thermo Fisher; Vector Backbone:pcDNA5-FRT-TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | codon optimized; gene expression was optimized by increasing the GC3 content within codons | 2026-08-15 01:08:08 | 0 | |
|
SARS-CoV-2_N_deltaNTD Resource Report Resource Website |
RRID:Addgene_157869 | N | SARS-CoV-2 | Kanamycin | PMID:33200826 | Vector Backbone:pTHMT; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | deltaNTD | 2026-08-15 01:08:09 | 0 | |
|
SARS-CoV-2_N_deltaCIDR Resource Report Resource Website |
RRID:Addgene_157872 | N | SARS-CoV-2 | Kanamycin | PMID:33200826 | Please note: This plasmid contains a D15H mutation in MBP. This mutation is not known to affect plasmid function. | Vector Backbone:pTHMT; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | deltaCIDR | 2026-08-15 01:08:10 | 0 |
|
SARS-CoV-2_N_deltaCTD Resource Report Resource Website |
RRID:Addgene_157871 | N | SARS-CoV-2 | Kanamycin | PMID:33200826 | Vector Backbone:pTHMT; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | deltaCTD | 2026-08-15 01:08:09 | 0 | |
|
SARS-CoV-2 Spike (S) Ectodomain Library B Resource Report Resource Website |
RRID:Addgene_157972 | SARS-CoV-2 S ectodomain | SARS-CoV-2 | Ampicillin | PMID:34416153 | Backbone Marker:Joachim Messing; Vector Backbone:Plasmid 50005: pUC19; Vector Types:Bacterial Expression, Yeast Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:08:11 | 0 | ||
|
SARS-CoV-2 Spike (S) Ectodomain Library A Resource Report Resource Website |
RRID:Addgene_157971 | SARS-CoV-2 S ectodomain | SARS-CoV-2 | Kanamycin | PMID:34416153 | Backbone Marker:Joachim Messing; Vector Backbone:Plasmid 50005: pUC19; Vector Types:Bacterial Expression, Yeast Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:08:10 | 0 | ||
|
pAS1_4x7SKPylT_EF1_Ub-*CoV2_ORF6 Resource Report Resource Website |
RRID:Addgene_162817 | Ub-(N-TAG)CoV2_ORF6 | SARS-CoV-2 | Ampicillin | PMID:33175524 | Protein sequence: (TAG)FHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID - UniProtKB - P0DTC6 (NS6_SARS2) | Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | CoV2_ORF6(Met1,Amber) | 2026-08-15 01:09:05 | 0 |
|
pAS1_4x7SKPylT_EF1_Ub-*CoV2_9b Resource Report Resource Website |
RRID:Addgene_162816 | Ub-(N-TAG)CoV2_9b | SARS-CoV-2 | Ampicillin | PMID:33175524 | Protein sequence: (TAG)DPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK - UniProtKB - P0DTD2 (ORF9B_SARS2) | Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | CoV2_9b(Met1,Amber) | 2026-08-15 01:09:05 | 0 |
|
pAS1_4x7SKPylT_EF1_Ub-*CoV2_ORF3b_alt Resource Report Resource Website |
RRID:Addgene_162821 | Ub-(N-TAG)CoV2_ORF3b_alt | SARS-CoV-2 | Ampicillin | PMID:33175524 | Alternative ORF3b as described in Hachim et. al., 2020, (doi:10.1038/s41590-020-0773-7) - Protein sequence: (TAG)AYCWRCTSCCFSERFQNHNPQKEMATSTLQGCSLCLQLAVVVCNSLLTPFARCCWP | Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin | CoV2_ORF3b_alt(Met1,Amber) | 2026-08-15 01:09:05 | 0 |
|
pSBbi-RP-CoV2/RBD-puro Resource Report Resource Website 1+ mentions |
RRID:Addgene_161793 | SARS-CoV-2 RBD | SARS-CoV-2 | Ampicillin | PMID:36619904 | The SARS-CoV-2 RBD insert was designed by Jorge L. Arias-Arias from Universidad de Costa Rica ([email protected]). This vector is suitable for transient transfection, but it was intended to be co-transfected with the transposase vector pCMV(CAT)T7-SB100 (Addgene Plasmid #34879) in order to generate stable mammalian cells for the production of SARS-CoV-2 RBD protein. This protein can be recovered from the cell culture medium by His-tag purification. The recombinant RBD is suitable for COVID-19 serology testing and monitoring of humoral responses in vaccinated population. | Backbone Marker:Eric Kowarz; Backbone Size:6625; Vector Backbone:pSBbi-RP (Addgene Plasmid #60513); Vector Types:Mammalian Expression, Transposon; Bacterial Resistance:Ampicillin | 2026-08-15 01:08:57 | 2 | |
|
pLEX307-SARS-CoV-2-3CL Resource Report Resource Website 1+ mentions |
RRID:Addgene_160278 | 3CL Protease | SARS-CoV-2 | Ampicillin | PMID:33910954 | This plasmid is stored and distributed in NEB Stable. It can also be used to transform NEB 10Beta. The authors have noticed that there are high rates of recombination in these generated vectors. All users are advised to sequence the vectors and run them on a gel to ensure they show the expected full length insert and plasmid size. In cases where recombination has occurred it is typically between the viral LTR elements in the vector although recombination between the gateway cloning sites has also been observed. Please visit https://doi.org/10.1101/2020.08.29.272864 for bioRxiv preprint. | Vector Backbone:pLEX_307; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:08:40 | 3 | |
|
pLEX307-SARS-CoV-2-3CL-C145A Resource Report Resource Website |
RRID:Addgene_160279 | 3CL Protease | SARS-CoV-2 | Ampicillin | PMID:33910954 | This plasmid is stored and distributed in NEB Stable. It can also be used to transform NEB 10Beta. The authors have noticed that there are high rates of recombination in these generated vectors. All users are advised to sequence the vectors and run them on a gel to ensure they show the expected full length insert and plasmid size. In cases where recombination has occurred it is typically between the viral LTR elements in the vector although recombination between the gateway cloning sites has also been observed. Please visit https://doi.org/10.1101/2020.08.29.272864 for bioRxiv preprint. | Vector Backbone:pLEX_307; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | C145A | 2026-08-15 01:08:37 | 0 |
|
pRSFDuet-sumo-NSP12 (SARS-CoV-2) Resource Report Resource Website 1+ mentions |
RRID:Addgene_159107 | NSP12 | SARS-CoV-2 | Kanamycin | PMID:32783916 | Please visit https://doi.org/10.1101/2020.07.08.194084 for bioRxiv preprint. | Backbone Marker:Novagen; Backbone Size:3000; Vector Backbone:pRSFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | None | 2026-08-15 01:08:25 | 3 |
|
pCAGGS-SARS2-S-FKO (NC-flag) Resource Report Resource Website |
RRID:Addgene_159363 | SARS-CoV-2 S protein | SARS-CoV-2 | Ampicillin | PMID:33243994 | Pseudotypes to the MLV vector but not efficiently to VSV or lentiviral vectors. Please visit https://www.biorxiv.org/content/10.1101/2020.06.12.148726v1 for bioRxiv preprint. | Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Furin-cleavage site mutation | 2026-08-15 01:08:26 | 0 |
|
pLVX-EF1alpha-SARS-CoV-2-nsp1-2xStrep-IRES-Puro Resource Report Resource Website 10+ mentions |
RRID:Addgene_141367 | SARS-CoV-2-nsp1 | SARS-CoV-2 | Ampicillin | PMID:32353859 | Please visit https://www.biorxiv.org/content/10.1101/2020.03.22.002386v3 for bioRxiv preprint. | Backbone Marker:Takara Bio; Backbone Size:8825; Vector Backbone:pLVX-EF1alpha-IRES-Puro; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | human codon optimized | 2026-08-15 01:06:48 | 14 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
