Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Rattus norvegicus
Genetic Insert: SYT1 and HaloTag
Vector Backbone Description: Vector Backbone:pEF (#11154); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36729040
Comments: Please visit https://www.biorxiv.org/content/10.1101/2022.02.08.479521v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_197280 Copy
Species: Rattus norvegicus
Genetic Insert: Synaptophysin
Vector Backbone Description: Vector Backbone:pEF; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29754754
Proper citation: RRID:Addgene_188981 Copy
Species: Rattus norvegicus
Genetic Insert: SLC6A4 Serotonin Transporter
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA 3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:17698848
Proper citation: RRID:Addgene_190174 Copy
Species: Rattus norvegicus
Genetic Insert: 3x-NLS-mScarlet-AMPKalpha2
Vector Backbone Description: Backbone Size:3994; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35790710
Proper citation: RRID:Addgene_192452 Copy
Species: Rattus norvegicus
Genetic Insert: Cb5 tail anchor
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: Transfection of this plasmid will express mCherry-fused to the N-terminus of Cb5 tail anchor sequence" "ITTVESNSSWWTNWVIPAISALVVALMYRLYMAED", which targets the cytoplasmic face of endoplasmic reticulum. There is a flexible, 7 aa linker "SGLRSGK", between mCherry and Cb5.
Proper citation: RRID:Addgene_177407 Copy
Species: Rattus norvegicus
Genetic Insert: MUNC13-1 MUN domain
Vector Backbone Description: Vector Backbone:pTEV; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38956381
Proper citation: RRID:Addgene_218889 Copy
Species: Rattus norvegicus
Genetic Insert: mVenus(Y145W)-mVenus(Y145W)-rat CaMK2 alpha(T286A)-mEGFP(A206K)
Vector Backbone Description: Backbone Size:4758; Vector Backbone:pCAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:39385027
Comments: Please visit https://www.biorxiv.org/content/10.1101/2023.08.01.549180v1.full.pdf for bioRxiv preprint.
Proper citation: RRID:Addgene_220367 Copy
Species: Rattus norvegicus
Genetic Insert: mVenus(Y145W)-mVenus(Y145W)-rat CaMK2 alpha(T305D/T306D)-mEGFP(A206K)
Vector Backbone Description: Backbone Size:4758; Vector Backbone:pCAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:39385027
Comments: Please visit https://www.biorxiv.org/content/10.1101/2023.08.01.549180v1.full.pdf for bioRxiv preprint.
Proper citation: RRID:Addgene_220368 Copy
Species: Rattus norvegicus
Genetic Insert: LAMP1
Vector Backbone Description: Backbone Size:10726; Vector Backbone:FUWG-RUSH-Strep-KDEL; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:40016183
Comments: Please visit https://doi.org/10.1101/2024.05.16.594502 for bioRxiv preprint.
Proper citation: RRID:Addgene_228526 Copy
Species: Rattus norvegicus
Genetic Insert: Rat Arc
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_233056 Copy
Species: Rattus norvegicus
Genetic Insert: LAP2b
Vector Backbone Description: Vector Backbone:n/a; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37098350
Proper citation: RRID:Addgene_228029 Copy
Species: Rattus norvegicus
Genetic Insert: CRISPRi single guide RNA sequence against 5’-UTR of rat synaptotagmin-1 (Syt1) gene (insert 5’ - CACCTCCTCCTGCAGCGGCAGCATCGG)
Vector Backbone Description: Backbone Marker:Dr Konstantin Kogan; Backbone Size:14900; Vector Backbone:pLV-hUV6-sgRNA-dCas9-KRAB-TagBFP; Vector Types:Lentiviral, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37226896
Proper citation: RRID:Addgene_202556 Copy
Species: Rattus norvegicus
Genetic Insert: macroH2A1.2-GFP
Vector Backbone Description: Backbone Size:4733; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:39189450
Proper citation: RRID:Addgene_223708 Copy
Species: Rattus norvegicus
Genetic Insert: His-DIO GCaMP8f
Vector Backbone Description: Backbone Size:4699; Vector Backbone:pX552; Vector Types:Mammalian Expression, AAV, Cre/Lox, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38871457
Comments: pX552 was a gift from Feng Zhang (Addgene plasmid # 60958 ; http://n2t.net/addgene:60958 ; RRID:Addgene_60958)
Proper citation: RRID:Addgene_199580 Copy
Species: Rattus norvegicus
Genetic Insert: Omp25
Vector Backbone Description: Backbone Size:6101; Vector Backbone:pMRX-IPU; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:39288101
Proper citation: RRID:Addgene_228137 Copy
Species: Rattus norvegicus
Genetic Insert: Rat Arc
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_233053 Copy
Species: Rattus norvegicus
Genetic Insert: 1EYH
Vector Backbone Description: Backbone Size:5679; Vector Backbone:pET29b; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:42555168
Comments: 5' cloning site: BsaI (destroyed), 3' cloning site: BsaI (destroyed)
Proper citation: RRID:Addgene_234159 Copy
Species: Rattus norvegicus
Genetic Insert: Neurofilament-Medium tail domain, charge shuffle 1
Vector Backbone Description: Backbone Size:5200; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:39602260
Proper citation: RRID:Addgene_232058 Copy
Species: Rattus norvegicus
Genetic Insert: Neurofilament-Heavy tail domain
Vector Backbone Description: Backbone Size:5200; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:39602260
Proper citation: RRID:Addgene_232057 Copy
Species: Rattus norvegicus
Genetic Insert: Neurofilament-Medium tail domain
Vector Backbone Description: Backbone Size:5200; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:39602260
Proper citation: RRID:Addgene_232056 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.