Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Rattus norvegicus
Genetic Insert: Letm1 shRNA Target sequence
Vector Backbone Description: Vector Backbone:pLKO.1 - TRC; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:41673453
Proper citation: RRID:Addgene_215365 Copy
Species: Rattus norvegicus
Genetic Insert: rPou5f1(ns):F2A:rKlf4:IRES:rSox2*:E2A:rMyc*
Vector Backbone Description: Vector Backbone:N/A; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:41605217
Proper citation: RRID:Addgene_249058 Copy
Species: Rattus norvegicus
Genetic Insert: Rattus rattus biliverdin reductase A flanked with an N-terminal plastid transit peptide and a C-terminal FLAG tag.
Vector Backbone Description: Vector Backbone:pGWB511; Vector Types:Bacterial Expression, Plant Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:37285441
Proper citation: RRID:Addgene_203480 Copy
Species: Rattus norvegicus
Genetic Insert: cacna1a
Vector Backbone Description: Backbone Marker:Invitrogen Life Technologies; Backbone Size:5446; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31577951
Comments: Grow mammalian cells at 30 C for protein expression
Proper citation: RRID:Addgene_206069 Copy
Species: Rattus norvegicus
Genetic Insert: cacnb1b
Vector Backbone Description: Backbone Marker:Invitrogen Life Technologies; Backbone Size:5446; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_206105 Copy
Species: Rattus norvegicus
Genetic Insert: cacna2d1
Vector Backbone Description: Backbone Marker:Invitrogen Life Technologies; Backbone Size:5446; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35238638
Proper citation: RRID:Addgene_206070 Copy
Species: Rattus norvegicus
Genetic Insert: cacna1a
Vector Backbone Description: Backbone Marker:PMID 11397804; Backbone Size:4890; Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:11606638
Proper citation: RRID:Addgene_206076 Copy
Species: Rattus norvegicus
Genetic Insert: NGF-Erbb2-2xFKBP-HA
Vector Backbone Description: Backbone Marker:Addgene #1765; Vector Backbone:pBabe hygro; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37055441
Proper citation: RRID:Addgene_192291 Copy
Species: Rattus norvegicus
Genetic Insert: Neuroligin-1
Vector Backbone Description: Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: This is a validated antigen plasmid of Anti-Neuroligin-1 [N97A/31R].
Proper citation: RRID:Addgene_197314 Copy
Species: Rattus norvegicus
Genetic Insert: COX2-Q6-L18 TALEN
Vector Backbone Description: Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37058569
Comments: These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG
Proper citation: RRID:Addgene_198844 Copy
Species: Rattus norvegicus
Genetic Insert: COX1-W25-L15 TALEN
Vector Backbone Description: Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37058569
Comments: These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG
Proper citation: RRID:Addgene_198842 Copy
Species: Rattus norvegicus
Genetic Insert: ATP8-W9-L17 TALEN
Vector Backbone Description: Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37058569
Comments: These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG
Proper citation: RRID:Addgene_198840 Copy
Species: Rattus norvegicus
Genetic Insert: ND4-W24-L18 TALEN
Vector Backbone Description: Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37058569
Comments: These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG
Proper citation: RRID:Addgene_198856 Copy
Species: Rattus norvegicus
Genetic Insert: ATP6-W68-L16 TALEN
Vector Backbone Description: Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37058569
Comments: These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG
Proper citation: RRID:Addgene_198838 Copy
Species: Rattus norvegicus
Genetic Insert: Gephyrin
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFPC2; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:36314779
Comments: Gephyrin C3 cassette encodes NHPFYTSPAVFMANHGQPIPGLISYSHHATGSADKR after K243 (Thought to be expressed in astrocytes for MoCo biosynthesis and prevents olgomerization of gephyrin molecules for synapse scaffolding function in neurons)
Proper citation: RRID:Addgene_199610 Copy
Species: Rattus norvegicus
Genetic Insert: CYTB-W77-R14 TALEN
Vector Backbone Description: Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37058569
Comments: These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG
Proper citation: RRID:Addgene_198849 Copy
Species: Rattus norvegicus
Genetic Insert: COX2-Q6-R18 TALEN
Vector Backbone Description: Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37058569
Comments: These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG
Proper citation: RRID:Addgene_198845 Copy
Species: Rattus norvegicus
Genetic Insert: ATP8-W9-R15 TALEN
Vector Backbone Description: Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37058569
Comments: These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG
Proper citation: RRID:Addgene_198841 Copy
Species: Rattus norvegicus
Genetic Insert: ND4-W24-R17 TALEN
Vector Backbone Description: Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37058569
Comments: These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG
Proper citation: RRID:Addgene_198857 Copy
Species: Rattus norvegicus
Genetic Insert: ATP6-W68-R17 TALEN
Vector Backbone Description: Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37058569
Comments: These plasmids may not be suitable for sequencing with NGS, because they contain RVD array. In our lab, we perform Sanger sequencing using the following primers: RVD seq Fwd TGACCGCAGTGGAGGCAGTG; RVD seq Rev TTCACTGCATCCAGCGCAGG
Proper citation: RRID:Addgene_198839 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
