Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: E. coli
Genetic Insert: msd_lacZ(ON)
Vector Backbone Description: Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61456 Copy
Species: E. coli
Genetic Insert: SCRIBE_lacZ(ON)
Vector Backbone Description: Vector Backbone:pZA31; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61457 Copy
Species: E. coli
Genetic Insert: SCRIBE_galK(ON)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZA21; Vector Types:Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61451 Copy
Species: E. coli
Genetic Insert: msd_kanR(ON)_dRT
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61452 Copy
Species: E. coli
Genetic Insert: msd(wt)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61453 Copy
Species: E. coli
Genetic Insert: msd_kanR(ON)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61447 Copy
Species: E. coli
Genetic Insert: SCRIBE_kanR(ON)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61448 Copy
Species: E. coli
Genetic Insert: SCRIBE_galK(OFF)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541
Proper citation: RRID:Addgene_61449 Copy
Species: E. coli
Genetic Insert: 'tesA
Vector Backbone Description: Backbone Size:0; Vector Backbone:p15a; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:20111002
Comments: EJ Steen et al. 2009 Nature 10.1038/nature08721
Proper citation: RRID:Addgene_24636 Copy
Species: E. coli
Genetic Insert: reverse tetracycline-regulated transactivator advanced
Vector Backbone Description: Backbone Marker:unpublished; Backbone Size:7200; Vector Backbone:pMA2635rc; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:19655272
Proper citation: RRID:Addgene_25435 Copy
Species: E. coli
Genetic Insert: KanR
Vector Backbone Description: Backbone Size:4361; Vector Backbone:pBR322; Vector Types:Synthetic Biology, Diatom Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25302562
Comments: Note: There are some small discrepancies between Addgene's quality control sequence and the assembled sequence from the depositor. They should not affect the function of the plasmid.
Proper citation: RRID:Addgene_56659 Copy
Species: E. coli
Genetic Insert: FtsZ-mEos2
Vector Backbone Description: Backbone Marker:NBRP-E.coli at NIG; Backbone Size:4500; Vector Backbone:pCA24N; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:23859153
Proper citation: RRID:Addgene_49764 Copy
Species: E. coli
Genetic Insert: Enhanced Circularly Permuted Outer Membrane Protein X
Vector Backbone Description: Backbone Size:5400; Vector Backbone:pBAD33; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:18480093
Proper citation: RRID:Addgene_23336 Copy
Species: E. coli
Genetic Insert: LexAp65
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:2664; Vector Backbone:pDONR P4r-P3r; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_41438 Copy
Species: E. coli
Genetic Insert: rpoN
Vector Backbone Description: Backbone Marker:novagen; Backbone Size:5708; Vector Backbone:pET15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:22341441
Proper citation: RRID:Addgene_41748 Copy
Species: E. coli
Genetic Insert: lacZ alpha
Vector Backbone Description: Vector Backbone:pEGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_61971 Copy
Species: E. coli
Genetic Insert: MG1655-tMMR
Vector Backbone Description: Vector Backbone:genomic; Vector Types:; Bacterial Resistance:Tetracycline
Defining Citation: PMID:24500200
Comments: For detailed use and MAGE, see:
1. Nyerges, Á. et al. Conditional DNA repair mutants enable highly precise genome engineering. Nucl. Acids Res. 42, e62–e62 (2014).
2. Gallagher, R. R., Li, Z., Lewis, A. O. & Isaacs, F. J. Rapid editing and evolution of bacterial genomes using libraries of synthetic DNA. Nat. Protocols 9, 2301–2316 (2014).
3. Bonde, M. T., Anderson, M. V., Wallin, A. I. N., Wang, H. H. & Sommer, M. O. A. MODEST: a web-based design tool for oligonucleotide-mediated genome engineering and recombineering. Nucl. Acids Res. (2014). doi:10.1093/nar/gku428
Proper citation: RRID:Addgene_62392 Copy
Species: E. coli
Genetic Insert: OmpA
Vector Backbone Description: Backbone Marker:DNA2.0; Backbone Size:4000; Vector Backbone:pJexpress414; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26199411
Comments: AA sequence: MKKTAIAIAVALAGFATVAQAAPNDNTWYTGAKLGWSQYHDTGFI
NNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLG
YPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWT
NNIGDYPYDVPDYATRPDNGMLSLGVSYRFGCCPGCCHHHHHH
Proper citation: RRID:Addgene_62646 Copy
Species: E. coli
Genetic Insert: Recoded E. coli genome with all instances of the UAG codon removed, but wild type UAG termination function is not changed
Vector Backbone Description: Vector Backbone:E. coli genome; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24136966
Comments: E. coli MG1655 delta(ybhB-bioAB)::[lcI857 N(cro-ea59)::tetR-bla] Delta mutS::zeoR; all 321 UAG codons changed to UAA
This strain is mutS-, which causes a spontaneous mutation frequency of ~2E-8. This strain is auxotrophic for d-biotin.
Sequence is similar to C321.DA (NCBI accession # NCBI CP006698), except that RF1 is not deleted.
Proper citation: RRID:Addgene_48999 Copy
Species: E. coli
Genetic Insert: PTac-RBSF1-AmeR-PAmeR-YFP
Vector Backbone Description: Backbone Marker:Alec Nielsen; Backbone Size:3930; Vector Backbone:pAN801; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:27034378
Proper citation: RRID:Addgene_74675 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
