Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Rattus norvegicus
Genetic Insert: Nedd1-mOrange2-rCM1
Vector Backbone Description: Backbone Size:8089; Vector Backbone:pBeta-actin-Nedd1-mOrange2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36796357
Proper citation: RRID:Addgene_196861 Copy
Species: Rattus norvegicus
Genetic Insert: Nedd1-mOrange2
Vector Backbone Description: Backbone Size:6040; Vector Backbone:pBeta-actin-Tubg1-mEGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36796357
Proper citation: RRID:Addgene_196860 Copy
Species: Rattus norvegicus
Genetic Insert: Nedd1-mOrange2-F75A
Vector Backbone Description: Backbone Size:8089; Vector Backbone:pBeta-actin-Nedd1-mOrange2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36796357
Proper citation: RRID:Addgene_196862 Copy
Species: Rattus norvegicus
Genetic Insert: AcGFP-Akap9 (128-425)
Vector Backbone Description: Backbone Size:6000; Vector Backbone:pBeta-actin; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36796357
Proper citation: RRID:Addgene_196871 Copy
Species: Rattus norvegicus
Genetic Insert: Synaptotagmin 4
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:4006; Vector Backbone:pCI; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:22398727
Comments: The first codon of the Synpatotagmin has been removed
Proper citation: RRID:Addgene_184505 Copy
Species: Rattus norvegicus
Genetic Insert: td-mCherry-Cdk5rap2
Vector Backbone Description: Backbone Size:7437; Vector Backbone:pBeta-actin-td-mCherry-CI; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36796357
Proper citation: RRID:Addgene_196859 Copy
Species: Rattus norvegicus
Genetic Insert: AcGFP-Cdk5rap2-CTD
Vector Backbone Description: Backbone Size:6748; Vector Backbone:pBeta-actin-AcGFP-CI ; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36796357
Proper citation: RRID:Addgene_196853 Copy
Species: Rattus norvegicus
Genetic Insert: enNTS1
Vector Backbone Description: Backbone Marker:Internal Lab Plasmid; Backbone Size:6112; Vector Backbone:pDS170; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36680775
Comments: For additional information, please refer to:
Bumbak et al. 2018 "Optimization and 13CH3 methionine labeling of a signaling competent neurotensin receptor 1 variant for NMR studies" BBA Biomembranes. https://doi.org/10.1016/j.bbamem.2018.03.020
Bumbak et al. 2019 "Expression and Purification of a Functional E. coli 13CH3-Methionine-Labeled Thermostable Neurotensin Receptor 1 Variant for Solution NMR Studies" Methods Mol Biol. https://doi.org/10.1007/978-1-4939-9121-1_3
Proper citation: RRID:Addgene_199152 Copy
Species: Rattus norvegicus
Genetic Insert: Map1lc3b
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3900; Vector Backbone:pEGFPc/PGK; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:37133994
Proper citation: RRID:Addgene_200083 Copy
Species: Rattus norvegicus
Genetic Insert: SLC6A4 Serotonin Transporter
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:11592963
Comments: Please also see:
Zhang YW, Turk BE, Rudnick G. Control of serotonin transporter phosphorylation by conformational state. Proc Natl Acad Sci U S A. 2016 May 17;113(20):E2776-83. doi: 10.1073/pnas.1603282113. Epub 2016 May 2. PMID: 27140629; PMCID: PMC4878475.
Proper citation: RRID:Addgene_190743 Copy
Species: Rattus norvegicus
Genetic Insert: rat serotonin transporter
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA 3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:17008313
Proper citation: RRID:Addgene_190177 Copy
Species: Rattus norvegicus
Genetic Insert: mScarlet-AMPKalpha2
Vector Backbone Description: Backbone Size:3994; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35790710
Proper citation: RRID:Addgene_192451 Copy
Species: Rattus norvegicus
Genetic Insert: GCaMP6s
Vector Backbone Description: Backbone Marker:n/a; Backbone Size:2900; Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37163565
Comments: Please visit https://www.biorxiv.org/content/10.1101/2022.10.17.512455v2 for bioRxiv preprint.
Proper citation: RRID:Addgene_192945 Copy
Species: Rattus norvegicus
Genetic Insert: Cb5 tail anchor
Vector Backbone Description: Vector Backbone:pLVX-EF1a-IRES-Puromycin; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Comments: Infection with this plasmid will express mCherry-fused to the N-terminus of Cb5 tail anchor sequence" "ITTVESNSSWWTNWVIPAISALVVALMYRLYMAED", which targets the cytoplasmic face of endoplasmic reticulum. There is a flexible, 7 aa linker "SGLRSGK", between mCherry and Cb5.
Proper citation: RRID:Addgene_177434 Copy
Species: Rattus norvegicus
Genetic Insert: mScarlet-Gphn (isoform P1)
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:3892; Vector Backbone:pAAV-MCS; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36543537
Proper citation: RRID:Addgene_194972 Copy
Species: Rattus norvegicus
Genetic Insert: PH domain from PLC delta1
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:36759616
Comments: Please visit https://doi.org/10.1101/2022.03.21.485138 for bioRxiv preprint.
Proper citation: RRID:Addgene_193568 Copy
Species: Rattus norvegicus
Genetic Insert: miRFP718nano-LC-Myosin
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36456785
Proper citation: RRID:Addgene_195748 Copy
Species: Rattus norvegicus
Genetic Insert: C-terminal glucocorticoid receptor, GR
Vector Backbone Description: Vector Backbone:pUAP4; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:37856867
Comments: Please visit https://doi.org/10.1101/2023.02.13.528283 for bioRxiv preprint.
Proper citation: RRID:Addgene_197535 Copy
Species: Rattus norvegicus
Genetic Insert: AP-2 σ2
Vector Backbone Description: Backbone Size:7987; Vector Backbone:pGADT7; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35976721
Proper citation: RRID:Addgene_198345 Copy
Species: Rattus norvegicus
Genetic Insert: AP-3 μ3B
Vector Backbone Description: Backbone Size:8117; Vector Backbone:pACT2; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24229647
Proper citation: RRID:Addgene_198175 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
