Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Organism:synthetic (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

30,421 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
EGFP-uTEV1-MAVS-mTA2
 
Resource Report
Resource Website 		RRID:Addgene_171000 EGFP-uTEV1-MAVS(tmd)[R537A, R538A] Synthetic Ampicillin PMID:34414886 Backbone Size:8000; Vector Backbone:pCW-Cas9; Vector Types:Mammalian Expression, Lentiviral, Synthetic Biology; Bacterial Resistance:Ampicillin MAVS(tmd)[R537A, R538A] 2026-08-15 01:10:13 0
POLArIS_NbVim-cp10GFP
 
Resource Report
Resource Website 		RRID:Addgene_171020 anti-vimentin-nanobody VB6 (NbVim) tagged with circularly permutated superfolderGFP(cp10GFP) Synthetic Ampicillin PMID:34090210 Backbone Marker:invitrogen; Backbone Size:3300; Vector Backbone:modified pcDNA3.1; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:10:12 0
bdSUMO-HA2-GFP-HiBit
 
Resource Report
Resource Website 		RRID:Addgene_171017 14x-His-bdSUMO-HA2-muGFP-HiBiT Synthetic Ampicillin PMID:34140497 Please visit https://www.biorxiv.org/content/10.1101/2020.08.20.258350v1 for bioRxiv preprint. Backbone Size:4694; Vector Backbone:pET His6 MBP TEV LIC cloning vector (2M-T); Vector Types:Bacterial Expression, Luciferase; Bacterial Resistance:Ampicillin 2026-08-15 01:10:12 0
bdSUMO-pHD118-GFP-HiBit
 
Resource Report
Resource Website 		RRID:Addgene_171015 14x-His-bdSUMO-pHD118-muGFP-HiBiT Synthetic Ampicillin PMID:34140497 Please visit https://www.biorxiv.org/content/10.1101/2020.08.20.258350v1 for bioRxiv preprint. Backbone Size:4694; Vector Backbone:pET His6 MBP TEV LIC cloning vector (2M-T); Vector Types:Bacterial Expression, Luciferase; Bacterial Resistance:Ampicillin 2026-08-15 01:10:13 0
bdSUMO-5.3-GFP-HiBit
 
Resource Report
Resource Website 		RRID:Addgene_171014 14x-His-bdSUMO-5.3-muGFP-HiBiT Synthetic Ampicillin PMID:34140497 Please visit https://www.biorxiv.org/content/10.1101/2020.08.20.258350v1 for bioRxiv preprint. Backbone Size:4694; Vector Backbone:pET His6 MBP TEV LIC cloning vector (2M-T); Vector Types:Bacterial Expression, Luciferase; Bacterial Resistance:Ampicillin 2026-08-15 01:10:12 0
EGFP-uTEV1-SQSfl
 
Resource Report
Resource Website 		RRID:Addgene_171010 EGFP-uTEV1-SQS(FL) Synthetic Ampicillin PMID:34414886 Backbone Size:8000; Vector Backbone:pCW-Cas9; Vector Types:Mammalian Expression, Lentiviral, Synthetic Biology; Bacterial Resistance:Ampicillin 2026-08-15 01:10:12 0
pPPC034
 
Resource Report
Resource Website 		RRID:Addgene_171153 J3(106)- BBa_J23111-sfGFP Synthetic Kanamycin PMID:33930546 Alternative names: pCK306, pGNW2-pp2_J3(106)-BBa_J23111-sfGFP Single cross-over into P. putida. Then, kanamycin resistant marker can be flipped out by pCK255 Backbone Marker:Jesse Zalatan; Backbone Size:6102; Vector Backbone:pGNW2-pp2; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:10:14 0
pPPC030.306
 
Resource Report
Resource Website 		RRID:Addgene_171151 J306 scRNA Synthetic Gentamicin PMID:33930546 Alternative names: pCK162, pBBR1-GmR_J3-BBa_J23117-mvaES Backbone Marker:Jesse Zalatan; Backbone Size:6261; Vector Backbone:pPPC020.306; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Gentamicin 2026-08-15 01:10:13 0
pCas12f1
 
Resource Report
Resource Website 		RRID:Addgene_171182 Cas12f1 Synthetic Kanamycin PMID:34023220 Backbone Size:8576; Vector Backbone:pCas; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin 2026-08-15 01:10:15 0
pPPC010.AAV
 
Resource Report
Resource Website 		RRID:Addgene_171175 hAAVS1 scRNA Synthetic Kanamycin PMID:33930546 Alternative names: pCK041.AAV, pBBR1-KmR_Sp.pCas9-dCas9_BBa_J23107-MCP-SoxS(R93A/S101A)_AAV Backbone Marker:Kenneth M. Peterson; Backbone Size:5148; Vector Backbone:pBBR1-MCS2; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin 2026-08-15 01:10:14 0
pPPC027.306
 
Resource Report
Resource Website 		RRID:Addgene_171149 J306 scRNA Synthetic Gentamicin PMID:33930546 Alternative names: pCK134, pBBR1-GmR_J3-BBa_J23117-GTPCH_J3-BBa_J23117-PTPS_J3-BBa_J23117-SR Backbone Marker:Jesse Zalatan; Backbone Size:6261; Vector Backbone:pPPC020.306; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Gentamicin 2026-08-15 01:10:13 0
pPPC019.AAV
 
Resource Report
Resource Website 		RRID:Addgene_171147 hAAVS1 scRNA Synthetic Kanamycin PMID:33930546 Alternative names: pCK080, pRK2-KmR_J1-BBa_J23117-mRFP_hAAVS1. Backbone Marker:Jesse Zalatan; Backbone Size:4577; Vector Backbone:pRK2-KmR; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin 2026-08-15 01:10:14 0
pPPC017.109
 
Resource Report
Resource Website 		RRID:Addgene_171145 J109 scRNA Synthetic Kanamycin PMID:33930546 Alternative names: pCK058, pBBR1-KmR_J1-mRFP_J109 Backbone Marker:Kenneth M. Peterson; Backbone Size:5148; Vector Backbone:pBBR1-MCS2; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin 2026-08-15 01:10:13 0
pPPC009.106
 
Resource Report
Resource Website 		RRID:Addgene_171142 J106 scRNA Synthetic Kanamycin PMID:33930546 Alternative names: pCK033.06, pBBR1-KmR_J106 Backbone Marker:Kenneth M. Peterson; Backbone Size:5148; Vector Backbone:pBBR1-MCS2; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin 2026-08-15 01:10:13 0
pPPC002
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_171139 J1-BBa_J23117-sfGFP Synthetic Gentamicin PMID:33930546 Alternative names: pCDP009, pUC18TminiTn7T-Gm_J1-BBa_J23117-sfGFP_Sp.pCas9-dCas9_BBa_J23107-MCP-SoxS(R93A/S101A) Used for conjugation, with pTNS1 and pRK2013 helper plasmids, to integrate J1-BBa_J23117-sfGFP, Sp.pCas9-dCas9, and BBa_J23107-MCP-SoxS(R93A/S101A) cassettes into gram-negative bacteria. Point mutation in the FRT site was observed and remained applicable with counterselection by pCK255 Backbone Marker:Herbert Schweizer; Backbone Size:4569; Vector Backbone:pUC18TminiTn7T-Gm; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Gentamicin 2026-08-15 01:10:14 1
pX601-miniCMV-SaCas9-U6-YFPvsSaCas9 sgRNA
 
Resource Report
Resource Website 		RRID:Addgene_107050 SaCas9 Synthetic Ampicillin YFP sgRNA for SaCas9 Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pX601-miniCMV-SaCas9-U6-LacZvsSaCas9 sgRNA
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_107049 SaCas9 Synthetic Ampicillin LacZ sgRNA for SaCas9 Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:01:08 1
pET21d-colEdes12/Imdes12
 
Resource Report
Resource Website 		RRID:Addgene_107120 colEdes12/Imdes12 Synthetic Ampicillin PMID:30538236 Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes12: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFKKKFWKEVSKDPDLSKQFKGSNRENIKQGIAPFARQKDQVGGRRVFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes12: MELKHSISDYTEAEFLEFVKEICQKNSAGELDESLFKLVTEFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pET15b-M1C
 
Resource Report
Resource Website 		RRID:Addgene_107085 M. sedula PCNA1 fused to CyPet Synthetic Ampicillin PMID:27228945 Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pET15b-YS3
 
Resource Report
Resource Website 		RRID:Addgene_107084 S. solfataricus PCNA3 fused to YPet Synthetic Ampicillin PMID:27228945 Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch