Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Mus musculus
Genetic Insert: Cdk2ap1
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5369; Vector Backbone:pET28a; Vector Types:Bacterial Expression, Nonviral; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34644528
Proper citation: RRID:Addgene_178032 Copy
Species: Mus musculus
Genetic Insert: Bcl11b MAR4
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:5010; Vector Backbone:pGL3-promoter; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29562171
Proper citation: RRID:Addgene_178188 Copy
Species: Mus musculus
Genetic Insert: pAAV CAG iGluSnFR3 v857.PDGFR
Vector Backbone Description: Backbone Size:4700; Vector Backbone:pAAV CAG; Vector Types:Mammalian Expression, Mouse Targeting, AAV, Cre/Lox, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37142767
Proper citation: RRID:Addgene_178333 Copy
Species: Mus musculus
Genetic Insert: pAAV GFAP iGluSnFR3 v857.SGZ
Vector Backbone Description: Backbone Size:4852; Vector Backbone:pAAV GFAP; Vector Types:Mammalian Expression, Mouse Targeting, AAV, Cre/Lox, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37142767
Proper citation: RRID:Addgene_178337 Copy
Species: Mus musculus
Genetic Insert: pAAV hSyn iGluSnFR3 v857.SGZ
Vector Backbone Description: Backbone Size:4200; Vector Backbone:pAAV hSyn; Vector Types:Mammalian Expression, Mouse Targeting, AAV, Cre/Lox, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37142767
Proper citation: RRID:Addgene_178330 Copy
Species: Mus musculus
Genetic Insert: Stargazin-mEGFP-iLID
Vector Backbone Description: Backbone Size:4720; Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34880255
Comments: The sequence and plasmid map is available in the following benchling link (https://benchling.com/s/seq-XUhPNN7CavWnbGAq1TUe).
Proper citation: RRID:Addgene_178523 Copy
Species: Mus musculus
Genetic Insert: H-2Kb
Vector Backbone Description: Backbone Marker:Chen lab; Backbone Size:7600; Vector Backbone:MDH1-454; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:17382377
Comments: This construct simultaneously expresses miR-181a and the H-2Kb gene.
Proper citation: RRID:Addgene_17847 Copy
Species: Mus musculus
Genetic Insert: NFATc3
Vector Backbone Description: Backbone Size:3000; Vector Backbone:pBluescript; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:11439183
Comments: Full-length mNFATc3
Proper citation: RRID:Addgene_17868 Copy
Species: Mus musculus
Genetic Insert: CnA alpha
Vector Backbone Description: Backbone Size:3300; Vector Backbone:pBJ5; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:1377362
Proper citation: RRID:Addgene_17871 Copy
Species: Mus musculus
Genetic Insert: murine Syk tandem SH2 domains (Ser 8 to Gln 264), the unphosphorylated form
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ
Proper citation: RRID:Addgene_111269 Copy
Species: Mus musculus
Genetic Insert: murine Syk (N)SH2 domain (Ser 8 to Gly 117), with an N-terminal (His)6 tag and TEV cleavage site
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MHHHHHHENLYFQGSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTG
Proper citation: RRID:Addgene_111274 Copy
Species: Mus musculus
Genetic Insert: murine Syk tandem SH2 domains (Ser 8 to Gln 264), with interdomain A (Phe 119 to His 162) substituted by a flexible 20aa linker
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPGGSGGSGGSGSGGSGGSGGSEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ
Proper citation: RRID:Addgene_111272 Copy
Species: Mus musculus
Genetic Insert: mCAR
Vector Backbone Description: Backbone Size:4832; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29879392
Proper citation: RRID:Addgene_111387 Copy
Species: Mus musculus
Genetic Insert: mCAR
Vector Backbone Description: Backbone Size:4836; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29879392
Proper citation: RRID:Addgene_111393 Copy
Species: Mus musculus
Genetic Insert: Cabp5 promoter
Vector Backbone Description: Backbone Size:3084; Vector Backbone:pCAGEN; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:14603031
Comments: The Cabp5 promoter is specific for bipolar cells in the retina
Proper citation: RRID:Addgene_11157 Copy
Species: Mus musculus
Genetic Insert: Gasdermin D
Vector Backbone Description: Vector Backbone:pCAG-FOS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29539421
Comments: Backbone is from Dr. Eiji Morita
Proper citation: RRID:Addgene_111565 Copy
Species: Mus musculus
Genetic Insert: mU6-sgRNA
Vector Backbone Description: Backbone Marker:Addgene; Backbone Size:8200; Vector Backbone:pSICO derivative; Vector Types:Mammalian Expression, Lentiviral, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30033366
Comments: Addgene NGS results identified a V163A variant in EGFP, which does not affect plasmid function.
Proper citation: RRID:Addgene_111596 Copy
Species: Mus musculus
Genetic Insert: H2Kb
Vector Backbone Description: Backbone Marker:Addgene # 60523; Backbone Size:5661; Vector Backbone:pSBbi-pur; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_111623 Copy
Species: Mus musculus
Genetic Insert: Bax
Vector Backbone Description: Backbone Marker:Mark Van Delft; Backbone Size:7006; Vector Backbone:pMIH/MSCV-IRES-hygro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29472455
Proper citation: RRID:Addgene_111628 Copy
Species: Mus musculus
Genetic Insert: TOMM20
Vector Backbone Description: Backbone Marker:Mark Van Delft; Backbone Size:6969; Vector Backbone:pMIH/MSCV-IRES-hygro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29472455
Proper citation: RRID:Addgene_111626 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
